StarFunc result for job id P31269

User Input

>input (272 residues)
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA
TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS
FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA
ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA
RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31269	0.999	0.999	1.481E-40	272	1.000	1.000	P31269.pdb.gz	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
2	AFDB:P31257	0.275	0.223	6.075E-11	342	0.353	0.281	P31257.pdb.gz	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
3	AFDB:P09632	0.228	0.254	8.070E-8	243	0.265	0.296	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
4	AFDB:P23812	0.249	0.253	6.178E-7	268	0.257	0.261	P23812.pdb.gz	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
5	AFDB:P31275	0.259	0.250	3.148E-6	282	0.261	0.252	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
6	AFDB:P31276	0.235	0.194	6.204E-6	330	0.261	0.215	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
7	AFDB:P97503	0.233	0.191	8.710E-6	333	0.188	0.153	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
8	AFDB:Q6ZNG2	0.233	0.188	9.976E-6	339	0.199	0.159	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
9	AFDB:A6YP92	0.234	0.117	1.499E-5	566	0.213	0.102	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
10	AFDB:Q14774	0.241	0.139	7.637E-5	488	0.239	0.133	Q14774.pdb.gz	HLX_HUMAN H2.0-like homeobox protein OS=Homo sapiens OX=9606 GN=HLX PE=1 SV=3
11	PDB:4egcA	0.172	0.087	3.277E-2	539	0.051	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.190	0.613	1.787E-1	73	0.059	0.219	2hi3A.pdb.gz
13	PDB:7fbyA	0.147	0.240	9.106E-1	153	0.033	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.139	0.308	1.043	113	0.044	0.106	5nr5A.pdb.gz
15	PDB:2cg4A	0.139	0.233	2.354	149	0.029	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:2cjjA	0.184	0.685	2.354	63	0.048	0.206	2cjjA.pdb.gz
17	PDB:4ldzA	0.143	0.186	3.088	196	0.033	0.046	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
18	PDB:5aj0BZ	0.150	0.407	3.785	86	0.037	0.116	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
19	PDB:7dcoL	0.138	0.091	3.785	435	0.044	0.028	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:1l3lB	0.123	0.140	4.051	233	0.044	0.052	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZSU5	0.0	548	271	0.974	0.978	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
2	P09631	0.0	553	271	0.982	0.985	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
3	P31269	0.0	568	272	1.000	1.000	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
4	A0A669K9T0	9.93e-162	449	225	0.827	1.000	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
5	A0A669KBC8	6.24e-74	226	213	0.393	0.502	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
6	Q9YGS6	1.39e-73	227	260	0.463	0.485	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
7	P20615	1.11e-72	224	250	0.482	0.524	HXB9_MOUSE Homeobox protein Hox-B9 OS=Mus musculus OX=10090 GN=Hoxb9 PE=2 SV=3
8	P17482	5.15e-71	220	250	0.482	0.524	HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2
9	A8MVF3	5.60e-71	215	106	0.386	0.991	A8MVF3_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
10	P09633	6.60e-67	210	260	0.504	0.527	HXC9_MOUSE Homeobox protein Hox-C9 OS=Mus musculus OX=10090 GN=Hoxc9 PE=2 SV=2
11	P31274	2.48e-66	209	260	0.500	0.523	HXC9_HUMAN Homeobox protein Hox-C9 OS=Homo sapiens OX=9606 GN=HOXC9 PE=1 SV=3
12	P28357	3.69e-41	146	339	0.235	0.189	HXD9_MOUSE Homeobox protein Hox-D9 OS=Mus musculus OX=10090 GN=Hoxd9 PE=2 SV=1
13	P28356	7.27e-41	146	352	0.235	0.182	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
14	Q53XI4	1.76e-36	134	342	0.232	0.184	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
15	Q9NYD6	1.76e-36	134	342	0.232	0.184	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
16	P31257	4.88e-36	133	342	0.235	0.187	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
17	P28359	2.10e-35	131	340	0.239	0.191	HXD10_MOUSE Homeobox protein Hox-D10 OS=Mus musculus OX=10090 GN=Hoxd10 PE=1 SV=2
18	P28358	3.13e-35	130	340	0.217	0.174	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
19	P31310	9.71e-35	131	416	0.206	0.135	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
20	P31260	1.26e-34	130	410	0.206	0.137	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3.5e-17	73.3	Homeodomain
2	PF04617 Hox9_act	3.9e-50	182.3	Hox9 activation region
3	PF13384 HTH_23	4.5e+02	12.2	Homeodomain-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343619

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272369	0.998	Homeobox protein Meis1
2	9606.ENSP00000405890	0.998	Pre-B-cell leukemia transcription factor 1
3	9606.ENSP00000362588	0.982	Pre-B-cell leukemia transcription factor 3
4	9606.ENSP00000341551	0.971	Mothers against decapentaplegic homolog 4
5	9606.ENSP00000316032	0.962	Nuclear pore complex protein Nup98-Nup96
6	9606.ENSP00000436786	0.936	Histone-lysine N-methyltransferase 2A
7	9606.ENSP00000364190	0.907	Pre-B-cell leukemia transcription factor 2
8	9606.ENSP00000369695	0.879	Protein AF-9
9	9606.ENSP00000283921	0.856	Homeobox protein Hox-A10
10	9606.ENSP00000425561	0.854	Eukaryotic translation initiation factor 4E
11	9606.ENSP00000482245	0.813	Dachshund homolog 1
12	9606.ENSP00000421799	0.800	Uncharacterized protein
13	9606.ENSP00000301764	0.790	DNA damage-binding protein 1
14	9606.ENSP00000284073	0.776	RNA-binding protein Musashi homolog 2
15	9606.ENSP00000364589	0.764	Cullin-4A
16	9606.ENSP00000252674	0.762	Protein ENL
17	9606.ENSP00000384863	0.734	Exportin-1
18	9606.ENSP00000356936	0.733	Fc receptor-like A
19	9606.ENSP00000381657	0.721	Histone-lysine N-methyltransferase, H3 lysine-79 specific
20	9606.ENSP00000307411	0.718	Protein AF-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0019899	0.995	enzyme binding
GO:0000981	0.929	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.791	transcription cis-regulatory region binding
GO:0001216	0.698	DNA-binding transcription activator activity
GO:0000977	0.568	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0050789	0.980	regulation of biological process
GO:0032502	0.977	developmental process
GO:0050794	0.966	regulation of cellular process
GO:0007275	0.965	multicellular organism development
GO:0048731	0.887	system development
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0080090	0.883	regulation of primary metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:0048518	0.880	positive regulation of biological process
GO:0031323	0.875	regulation of cellular metabolic process
GO:0010468	0.869	regulation of gene expression
GO:0048513	0.868	animal organ development
GO:0019219	0.865	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.862	regulation of cellular biosynthetic process
GO:0051252	0.862	regulation of RNA metabolic process
GO:0048522	0.855	positive regulation of cellular process
GO:0010556	0.833	regulation of macromolecule biosynthetic process
GO:0006355	0.782	regulation of DNA-templated transcription
GO:0009893	0.778	positive regulation of metabolic process
GO:0010604	0.770	positive regulation of macromolecule metabolic process
GO:0051173	0.759	positive regulation of nitrogen compound metabolic process
GO:0048519	0.726	negative regulation of biological process
GO:0031325	0.712	positive regulation of cellular metabolic process
GO:0048523	0.649	negative regulation of cellular process
GO:0006357	0.613	regulation of transcription by RNA polymerase II
GO:0001775	0.586	cell activation
GO:0000003	0.571	reproduction
GO:0050896	0.562	response to stimulus
GO:0022414	0.530	reproductive process
GO:0045935	0.506	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.487	positive regulation of RNA metabolic process
GO:0009891	0.483	positive regulation of biosynthetic process
GO:0045893	0.470	positive regulation of DNA-templated transcription
GO:0071704	0.451	organic substance metabolic process
GO:0045944	0.442	positive regulation of transcription by RNA polymerase II
GO:0044238	0.424	primary metabolic process
GO:0006807	0.418	nitrogen compound metabolic process
GO:0043170	0.414	macromolecule metabolic process
GO:0044237	0.372	cellular metabolic process
GO:0009892	0.336	negative regulation of metabolic process
GO:0010605	0.306	negative regulation of macromolecule metabolic process
GO:0051172	0.300	negative regulation of nitrogen compound metabolic process
GO:0031324	0.300	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0005737	0.686	cytoplasm
GO:0005667	0.317	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]