StarFunc result for job id P31270

User Input

>input (313 residues)
MDFDERGPCSSNMYLPSCTYYVSGPDFSSLPSFLPQTPSSRPMTYSYSSNLPQVQPVREV
TFREYAIEPATKWHPRGNLAHCYSAEELVHRDCLQAPSAAGVPGDVLAKSSANVYHHPTP
AVSSNFYSTVGRNGVLPQAFDQFFETAYGTPENLASSDYPGDKSAEKGPPAATATSAAAA
AAATGAPATSSSDSGGGGGCRETAAAAEEKERRRRPESSSSPESSSGHTEDKAGGSSGQR
TRKKRCPYTKYQIRELEREFFFSVYINKEKRLQLSRMLNLTDRQVKIWFQNRRMKEKKIN
RDRLQYYSANPLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RYB5	0.252	0.252	2.615E-39	313	0.971	0.971	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
2	AFDB:P28358	0.223	0.206	5.284E-9	340	0.268	0.247	P28358.pdb.gz	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
3	AFDB:P97503	0.232	0.220	1.082E-6	333	0.195	0.183	P97503.pdb.gz	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
4	AFDB:P82976	0.214	0.163	3.772E-6	418	0.259	0.194	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
5	AFDB:P09085	0.189	0.140	4.302E-6	427	0.227	0.166	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
6	AFDB:Q9NY43	0.239	0.197	5.975E-6	387	0.188	0.152	Q9NY43.pdb.gz	BARH2_HUMAN BarH-like 2 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL2 PE=1 SV=2
7	AFDB:P02833	0.181	0.150	1.826E-5	378	0.211	0.175	P02833.pdb.gz	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
8	AFDB:P83949	0.243	0.200	2.700E-4	389	0.220	0.177	P83949.pdb.gz	UBX_DROME Homeotic protein ultrabithorax OS=Drosophila melanogaster OX=7227 GN=Ubx PE=1 SV=1
9	AFDB:Q5U1D9	0.193	0.081	2.361E-3	837	0.173	0.065	Q5U1D9.pdb.gz	Q5U1D9_DROME SD09647p OS=Drosophila melanogaster OX=7227 GN=Vsx1 PE=2 SV=1
10	AFDB:O18381	0.241	0.096	1.392E-2	857	0.204	0.075	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
11	PDB:4egcA	0.152	0.088	1.486E-2	539	0.038	0.022	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.165	0.595	1.388E-1	73	0.038	0.164	2hi3A.pdb.gz
13	PDB:7fbyA	0.130	0.239	8.181E-1	153	0.038	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.131	0.395	1.478	86	0.038	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5nr5A	0.112	0.254	1.578	113	0.035	0.097	5nr5A.pdb.gz
16	PDB:2cg4A	0.126	0.241	2.192	149	0.016	0.034	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:2cjjA	0.126	0.454	2.500	63	0.032	0.159	2cjjA.pdb.gz
18	PDB:5x6cA	0.097	0.059	3.472	539	0.016	0.009	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
19	PDB:5mrca	0.109	0.183	3.708	177	0.048	0.085	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
20	PDB:2rvqD	0.085	0.167	3.960	129	0.045	0.109	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RYB5	0.0	624	313	0.971	0.971	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
2	G3V6Z0	0.0	625	313	0.974	0.974	G3V6Z0_RAT Homeobox A11 OS=Rattus norvegicus OX=10116 GN=Hoxa11 PE=3 SV=1
3	H0YIA6	0.0	540	283	0.834	0.922	H0YIA6_HUMAN Homeobox A11 (Fragment) OS=Homo sapiens OX=9606 GN=HOXA11 PE=1 SV=1
4	P31270	0.0	648	313	1.000	1.000	HXA11_HUMAN Homeobox protein Hox-A11 OS=Homo sapiens OX=9606 GN=HOXA11 PE=2 SV=2
5	P31311	0.0	624	313	0.974	0.974	HXA11_MOUSE Homeobox protein Hox-A11 OS=Mus musculus OX=10090 GN=Hoxa11 PE=1 SV=2
6	O43248	8.00e-89	269	304	0.518	0.533	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
7	P31313	5.37e-88	267	304	0.518	0.533	HXC11_MOUSE Homeobox protein Hox-C11 OS=Mus musculus OX=10090 GN=Hoxc11 PE=2 SV=3
8	P31277	6.95e-77	240	338	0.518	0.479	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3
9	P23813	2.58e-73	230	323	0.505	0.489	HXD11_MOUSE Homeobox protein Hox-D11 OS=Mus musculus OX=10090 GN=Hoxd11 PE=2 SV=2
10	J3KMZ0	3.45e-36	135	378	0.240	0.198	J3KMZ0_HUMAN Homeobox C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
11	P31260	3.85e-29	117	410	0.230	0.176	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3
12	P31310	3.44e-28	114	416	0.217	0.163	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
13	P31257	3.83e-27	110	342	0.179	0.164	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
14	Q53XI4	5.42e-27	110	342	0.173	0.158	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
15	Q9NYD6	5.42e-27	110	342	0.173	0.158	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
16	A0A669KBC8	2.84e-26	105	213	0.137	0.202	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
17	A0A669K9T0	4.87e-26	105	225	0.137	0.191	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
18	D3ZSU5	4.97e-26	106	271	0.137	0.159	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
19	P09631	5.07e-26	106	271	0.137	0.159	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
20	P31269	5.86e-26	105	272	0.137	0.158	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08070 DTHCT	6.3	19.0	DTHCT (NUC029) region
2	PF12045 DUF3528	2.3e-56	201.5	Protein of unknown function (DUF3528)
3	PF05920 Homeobox_KN	2.4e+02	13.0	Homeobox KN domain
4	PF00046 Homeodomain	1.5e-16	71.3	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000006015

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368880	0.965	Forkhead box protein O1
2	9606.ENSP00000230056	0.786	Geminin
3	9606.ENSP00000272369	0.703	Homeobox protein Meis1
4	9606.ENSP00000304502	0.679	Homeobox protein SIX2
5	9606.ENSP00000222753	0.674	Homeobox protein Hox-A13
6	9606.ENSP00000283921	0.594	Homeobox protein Hox-A10
7	9606.ENSP00000240335	0.556	T-box transcription factor TBX4
8	9606.ENSP00000304408	0.556	Collagen alpha-1(III) chain
9	9606.ENSP00000320147	0.554	Histone-lysine N-methyltransferase EZH2
10	9606.ENSP00000364190	0.551	Pre-B-cell leukemia transcription factor 2
11	9606.ENSP00000264162	0.518	Lactase-phlorizin hydrolase
12	9606.ENSP00000343619	0.515	Homeobox protein Hox-A9
13	9606.ENSP00000430432	0.515	Histone deacetylase 2
14	9606.ENSP00000405890	0.505	Pre-B-cell leukemia transcription factor 1
15	9606.ENSP00000265395	0.502	3-hydroxyisobutyrate dehydrogenase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0003700	0.985	DNA-binding transcription factor activity
GO:0000976	0.932	transcription cis-regulatory region binding
GO:0000977	0.904	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.811	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.991	developmental process
GO:0032501	0.988	multicellular organismal process
GO:0048856	0.982	anatomical structure development
GO:0007275	0.935	multicellular organism development
GO:0050789	0.915	regulation of biological process
GO:0050794	0.880	regulation of cellular process
GO:0048731	0.879	system development
GO:0048513	0.871	animal organ development
GO:0009987	0.838	cellular process
GO:0019222	0.788	regulation of metabolic process
GO:0060255	0.776	regulation of macromolecule metabolic process
GO:0010468	0.773	regulation of gene expression
GO:0010556	0.773	regulation of macromolecule biosynthetic process
GO:0031326	0.772	regulation of cellular biosynthetic process
GO:0051252	0.772	regulation of RNA metabolic process
GO:0006355	0.658	regulation of DNA-templated transcription
GO:0048518	0.655	positive regulation of biological process
GO:0050896	0.651	response to stimulus
GO:0061458	0.646	reproductive system development
GO:0048522	0.623	positive regulation of cellular process
GO:0009893	0.555	positive regulation of metabolic process
GO:0010604	0.544	positive regulation of macromolecule metabolic process
GO:0009653	0.519	anatomical structure morphogenesis
GO:0051173	0.500	positive regulation of nitrogen compound metabolic process
GO:0031325	0.497	positive regulation of cellular metabolic process
GO:0006357	0.493	regulation of transcription by RNA polymerase II
GO:0048608	0.476	reproductive structure development
GO:0048519	0.428	negative regulation of biological process
GO:0045893	0.371	positive regulation of DNA-templated transcription
GO:0048523	0.321	negative regulation of cellular process
GO:0045944	0.318	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.866	protein-containing complex
GO:0005667	0.309	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]