StarFunc result for job id P31271

User Input

>input (388 residues)
MTASVLLHPRWIEPTVMFLYDNGGGLVADELNKNMEGAAAAAAAAAAAAAAGAGGGGFPH
PAAAAAGGNFSVAAAAAAAAAAAANQCRNLMAHPAPLAPGAASAYSSAPGEAPPSAAAAA
AAAAAAAAAAAAASSSGGPGPAGPAGAEAAKQCSPCSAAAQSSSGPAALPYGYFGSGYYP
CARMGPHPNAIKSCAQPASAAAAAAFADKYMDTAGPAAEEFSSRAKEFAFYHQGYAAGPY
HHHQPMPGYLDMPVVPGLGGPGESRHEPLGLPMESYQPWALPNGWNGQMYCPKEQAQPPH
LWKSTLPDVVSHPSDASSYRRGRKKRVPYTKVQLKELEREYATNKFITKDKRRRISATTN
LSERQVTIWFQNRRVKEKKVINKLKTTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31271	0.999	0.999	1.879E-53	388	1.000	1.000	P31271.pdb.gz	HXA13_HUMAN Homeobox protein Hox-A13 OS=Homo sapiens OX=9606 GN=HOXA13 PE=1 SV=3
2	AFDB:P79724	0.265	0.333	4.088E-22	289	0.513	0.689	P79724.pdb.gz	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
3	AFDB:P31276	0.262	0.297	1.437E-18	330	0.441	0.518	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
4	AFDB:P31275	0.172	0.236	1.616E-6	282	0.147	0.202	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
5	AFDB:B2RYB5	0.173	0.213	8.493E-6	313	0.147	0.182	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
6	AFDB:P49639	0.155	0.180	1.265E-5	335	0.165	0.191	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
7	AFDB:A6YP92	0.175	0.124	1.352E-5	566	0.235	0.161	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
8	AFDB:Q5U1D9	0.163	0.079	2.299E-5	837	0.178	0.082	Q5U1D9.pdb.gz	Q5U1D9_DROME SD09647p OS=Drosophila melanogaster OX=7227 GN=Vsx1 PE=2 SV=1
9	AFDB:P09085	0.166	0.152	2.625E-5	427	0.183	0.166	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
10	AFDB:Q9NHP8	0.182	0.140	8.853E-4	513	0.188	0.142	Q9NHP8.pdb.gz	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
11	PDB:4egcA	0.120	0.087	8.521E-3	539	0.036	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.124	0.563	4.787E-2	73	0.036	0.192	2hi3A.pdb.gz
13	PDB:7fbyA	0.099	0.222	4.887E-1	153	0.031	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:3ndbB	0.113	0.105	1.084	420	0.026	0.024	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
15	PDB:2cyyA	0.103	0.231	1.238	151	0.036	0.093	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
16	PDB:5nr5A	0.103	0.313	1.614	113	0.031	0.106	5nr5A.pdb.gz
17	PDB:5aj0BZ	0.106	0.388	2.105	86	0.028	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:5mrca	0.093	0.183	2.105	177	0.034	0.073	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:5z56L	0.114	0.128	2.250	342	0.015	0.018	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:2ffhA	0.115	0.110	2.404	407	0.026	0.025	2ffhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K6K0	0.0	759	386	0.985	0.990	A0A0G2K6K0_RAT Homeo box A13 OS=Rattus norvegicus OX=10116 GN=Hoxa13 PE=3 SV=2
2	P31271	0.0	771	388	1.000	1.000	HXA13_HUMAN Homeobox protein Hox-A13 OS=Homo sapiens OX=9606 GN=HOXA13 PE=1 SV=3
3	Q62424	0.0	759	386	0.987	0.992	HXA13_MOUSE Homeobox protein Hox-A13 OS=Mus musculus OX=10090 GN=Hoxa13 PE=1 SV=1
4	P79724	6.67e-123	358	289	0.531	0.713	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
5	Q6W990	2.09e-116	343	310	0.534	0.668	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
6	Q6JIY5	2.89e-84	260	306	0.436	0.552	HXCDA_DANRE Homeobox protein Hox-C13a OS=Danio rerio OX=7955 GN=hoxc13a PE=2 SV=1
7	Q6JIY4	9.67e-81	250	273	0.348	0.495	HXCDB_DANRE Homeobox protein Hox-C13b OS=Danio rerio OX=7955 GN=hoxc13b PE=2 SV=1
8	P31276	2.57e-74	236	330	0.425	0.500	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
9	P50207	3.16e-74	236	328	0.425	0.503	HXC13_MOUSE Homeobox protein Hox-C13 OS=Mus musculus OX=10090 GN=Hoxc13 PE=2 SV=2
10	P35453	3.18e-74	236	343	0.343	0.388	HXD13_HUMAN Homeobox protein Hox-D13 OS=Homo sapiens OX=9606 GN=HOXD13 PE=1 SV=3
11	D4ACD0	3.44e-72	231	339	0.412	0.472	D4ACD0_RAT Homeo box D13 OS=Rattus norvegicus OX=10116 GN=Hoxd13 PE=3 SV=3
12	P70217	3.44e-72	231	339	0.412	0.472	HXD13_MOUSE Homeobox protein Hox-D13 OS=Mus musculus OX=10090 GN=Hoxd13 PE=1 SV=2
13	P70321	9.06e-71	225	286	0.361	0.490	HXB13_MOUSE Homeobox protein Hox-B13 OS=Mus musculus OX=10090 GN=Hoxb13 PE=2 SV=1
14	D3ZWL5	1.67e-70	224	286	0.358	0.486	D3ZWL5_RAT Homeo box B13 OS=Rattus norvegicus OX=10116 GN=Hoxb13 PE=3 SV=1
15	Q92826	1.94e-69	222	284	0.351	0.479	HXB13_HUMAN Homeobox protein Hox-B13 OS=Homo sapiens OX=9606 GN=HOXB13 PE=1 SV=2
16	P31277	2.62e-19	90.1	338	0.095	0.109	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3
17	O43248	3.11e-19	89.4	304	0.093	0.118	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
18	P23813	3.57e-19	89.7	323	0.095	0.115	HXD11_MOUSE Homeobox protein Hox-D11 OS=Mus musculus OX=10090 GN=Hoxd11 PE=2 SV=2
19	P31313	4.20e-19	89.0	304	0.093	0.118	HXC11_MOUSE Homeobox protein Hox-C11 OS=Mus musculus OX=10090 GN=Hoxc11 PE=2 SV=3
20	P31270	6.11e-19	88.6	313	0.098	0.121	HXA11_HUMAN Homeobox protein Hox-A11 OS=Homo sapiens OX=9606 GN=HOXA11 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	6.9	18.0	Homeobox KN domain
2	PF00046 Homeodomain	1.1e-14	65.3	Homeodomain
3	PF12284 HoxA13_N	2.7e-17	74.9	Hox protein A13 N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272369	0.712	Homeobox protein Meis1
2	9606.ENSP00000425561	0.704	Eukaryotic translation initiation factor 4E
3	9606.ENSP00000441954	0.689	Mothers against decapentaplegic homolog 5
4	9606.ENSP00000006015	0.674	Homeobox protein Hox-A11
5	9606.ENSP00000453793	0.625	Homeobox protein Meis2
6	9606.ENSP00000251453	0.618	Ribosomal protein S16
7	9606.ENSP00000283921	0.566	Homeobox protein Hox-A10
8	9606.ENSP00000351446	0.553	WD repeat-containing protein 5
9	9606.ENSP00000375730	0.539	60S ribosomal protein L13a
10	9606.ENSP00000405890	0.534	Pre-B-cell leukemia transcription factor 1
11	9606.ENSP00000264634	0.521	Protein Wnt-5a
12	9606.ENSP00000321797	0.517	Fibroblast growth factor 8
13	9606.ENSP00000240335	0.508	T-box transcription factor TBX4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.974	DNA-binding transcription factor activity
GO:0000981	0.956	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001067	0.948	transcription regulatory region nucleic acid binding
GO:0005515	0.940	protein binding
GO:0000976	0.931	transcription cis-regulatory region binding
GO:0000977	0.883	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.798	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.776	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001216	0.765	DNA-binding transcription activator activity
GO:0001228	0.760	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0048856	0.993	anatomical structure development
GO:0032501	0.992	multicellular organismal process
GO:0007275	0.975	multicellular organism development
GO:0050789	0.964	regulation of biological process
GO:0050794	0.945	regulation of cellular process
GO:0048513	0.935	animal organ development
GO:0048731	0.922	system development
GO:0060255	0.901	regulation of macromolecule metabolic process
GO:0010468	0.863	regulation of gene expression
GO:0009987	0.837	cellular process
GO:0031323	0.806	regulation of cellular metabolic process
GO:0080090	0.802	regulation of primary metabolic process
GO:0051171	0.802	regulation of nitrogen compound metabolic process
GO:0009889	0.758	regulation of biosynthetic process
GO:0019219	0.755	regulation of nucleobase-containing compound metabolic process
GO:0009653	0.750	anatomical structure morphogenesis
GO:0010556	0.750	regulation of macromolecule biosynthetic process
GO:0031326	0.750	regulation of cellular biosynthetic process
GO:0048518	0.705	positive regulation of biological process
GO:0051252	0.689	regulation of RNA metabolic process
GO:0006355	0.682	regulation of DNA-templated transcription
GO:0048522	0.669	positive regulation of cellular process
GO:0009893	0.663	positive regulation of metabolic process
GO:0010604	0.632	positive regulation of macromolecule metabolic process
GO:0050896	0.621	response to stimulus
GO:0031325	0.595	positive regulation of cellular metabolic process
GO:0051173	0.580	positive regulation of nitrogen compound metabolic process
GO:0045935	0.515	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.441	regulation of transcription by RNA polymerase II
GO:0010557	0.438	positive regulation of macromolecule biosynthetic process
GO:0031328	0.436	positive regulation of cellular biosynthetic process
GO:0051254	0.436	positive regulation of RNA metabolic process
GO:0045893	0.421	positive regulation of DNA-templated transcription
GO:0045944	0.393	positive regulation of transcription by RNA polymerase II
GO:0048519	0.369	negative regulation of biological process
GO:0048523	0.328	negative regulation of cellular process
GO:0009892	0.317	negative regulation of metabolic process
GO:0001501	0.309	skeletal system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.987	nucleoplasm
GO:0005737	0.706	cytoplasm
GO:0043232	0.382	intracellular non-membrane-bounded organelle
GO:0045111	0.365	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]