StarFunc result for job id P31273

User Input

>input (242 residues)
MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF
HHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANT
NSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRI
EVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN
KD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P09025	0.694	0.694	1.885E-32	242	0.996	0.996	P09025.pdb.gz	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
2	AFDB:Q68EH7	0.368	0.355	4.071E-27	250	0.785	0.760	Q68EH7.pdb.gz	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
3	AFDB:P09632	0.316	0.314	1.010E-19	243	0.620	0.617	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
4	AFDB:P13378	0.319	0.271	1.249E-15	290	0.521	0.434	P13378.pdb.gz	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
5	AFDB:P09024	0.329	0.363	6.456E-11	217	0.368	0.410	P09024.pdb.gz	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
6	AFDB:P31267	0.312	0.322	3.732E-10	233	0.335	0.348	P31267.pdb.gz	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2
7	AFDB:P32043	0.289	0.313	6.699E-10	222	0.306	0.333	P32043.pdb.gz	HXC5_MOUSE Homeobox protein Hox-C5 OS=Mus musculus OX=10090 GN=Hoxc5 PE=2 SV=3
8	AFDB:P09021	0.288	0.260	6.513E-9	270	0.343	0.307	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
9	AFDB:A5PLE8	0.244	0.233	1.966E-8	255	0.285	0.271	A5PLE8.pdb.gz	A5PLE8_DANRE Caudal type homeobox 1 b OS=Danio rerio OX=7955 GN=zgc:165581 PE=2 SV=1
10	AFDB:A0A024RAZ6	0.279	0.260	4.884E-8	260	0.277	0.258	A0A024RAZ6.pdb.gz
11	PDB:4egcA	0.181	0.081	6.219E-3	539	0.066	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.212	0.613	3.595E-2	73	0.066	0.219	2hi3A.pdb.gz
13	PDB:7fbyA	0.157	0.231	7.625E-1	153	0.041	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:2cg4A	0.138	0.212	9.266E-1	149	0.033	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
15	PDB:5aj0BZ	0.168	0.408	1.558	86	0.045	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
16	PDB:5z56L	0.175	0.128	1.663	342	0.041	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
17	PDB:2cjjA	0.198	0.606	1.894	63	0.062	0.238	2cjjA.pdb.gz
18	PDB:5nr5A	0.149	0.284	1.894	113	0.054	0.115	5nr5A.pdb.gz
19	PDB:2h09A	0.116	0.198	2.157	127	0.021	0.039	2h09A.pdb.gz
20	PDB:5mrca	0.137	0.182	2.157	177	0.058	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09025	0.0	503	242	0.996	0.996	HXC8_MOUSE Homeobox protein Hox-C8 OS=Mus musculus OX=10090 GN=Hoxc8 PE=1 SV=2
2	P31273	0.0	505	242	1.000	1.000	HXC8_HUMAN Homeobox protein Hox-C8 OS=Homo sapiens OX=9606 GN=HOXC8 PE=1 SV=2
3	Q68EH7	1.52e-146	410	250	0.781	0.756	HXC8A_DANRE Homeobox protein Hox-C8a OS=Danio rerio OX=7955 GN=hoxc8a PE=2 SV=1
4	Q8AWZ0	1.87e-104	304	245	0.607	0.600	HXB8A_DANRE Homeobox protein Hox-B8a OS=Danio rerio OX=7955 GN=hoxb8a PE=2 SV=1
5	I3L3R1	6.53e-101	295	242	0.628	0.628	I3L3R1_HUMAN Homeobox B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
6	P17481	4.26e-99	290	243	0.628	0.626	HXB8_HUMAN Homeobox protein Hox-B8 OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=2
7	P09632	8.61e-98	287	243	0.607	0.605	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
8	P13378	1.70e-86	260	290	0.636	0.531	HXD8_HUMAN Homeobox protein Hox-D8 OS=Homo sapiens OX=9606 GN=HOXD8 PE=1 SV=2
9	P23463	3.63e-85	256	289	0.645	0.540	HXD8_MOUSE Homeobox protein Hox-D8 OS=Mus musculus OX=10090 GN=Hoxd8 PE=3 SV=4
10	P02830	7.48e-41	141	229	0.421	0.445	HXA7_MOUSE Homeobox protein Hox-A7 OS=Mus musculus OX=10090 GN=Hoxa7 PE=2 SV=2
11	P31268	1.10e-38	136	230	0.393	0.413	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
12	P09024	2.52e-38	134	217	0.405	0.452	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
13	I3L383	9.15e-37	127	128	0.244	0.461	I3L383_HUMAN Homeobox B8 (Fragment) OS=Homo sapiens OX=9606 GN=HOXB8 PE=1 SV=1
14	P09629	7.61e-35	125	217	0.384	0.429	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
15	P17509	5.47e-33	121	224	0.372	0.402	HXB6_HUMAN Homeobox protein Hox-B6 OS=Homo sapiens OX=9606 GN=HOXB6 PE=1 SV=4
16	P09023	1.11e-32	120	224	0.376	0.406	HXB6_MOUSE Homeobox protein Hox-B6 OS=Mus musculus OX=10090 GN=Hoxb6 PE=1 SV=2
17	P02833	1.63e-32	123	378	0.244	0.156	ANTP_DROME Homeotic protein antennapedia OS=Drosophila melanogaster OX=7227 GN=Antp PE=1 SV=1
18	P09630	1.46e-30	115	235	0.347	0.357	HXC6_HUMAN Homeobox protein Hox-C6 OS=Homo sapiens OX=9606 GN=HOXC6 PE=2 SV=3
19	P10629	1.46e-30	115	235	0.347	0.357	HXC6_MOUSE Homeobox protein Hox-C6 OS=Mus musculus OX=10090 GN=Hoxc6 PE=2 SV=2
20	P09092	2.26e-30	114	232	0.413	0.431	HXA6_MOUSE Homeobox protein Hox-A6 OS=Mus musculus OX=10090 GN=Hoxa6 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	15	16.9	Homeobox KN domain
2	PF00046 Homeodomain	1.9e-18	77.3	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000040584

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000288840	0.954	Mothers against decapentaplegic homolog 6
2	9606.ENSP00000426568	0.835	Mothers against decapentaplegic homolog 1
3	9606.ENSP00000350049	0.771	Homeobox and leucine zipper protein Homez
4	9606.ENSP00000385347	0.764	Transmembrane anterior posterior transformation protein 1 homolog
5	9606.ENSP00000383920	0.687	Putative Polycomb group protein ASXL2
6	9606.ENSP00000302836	0.655	Homeobox protein Hox-C9
7	9606.ENSP00000269197	0.653	Putative Polycomb group protein ASXL3
8	9606.ENSP00000405890	0.649	Pre-B-cell leukemia transcription factor 1
9	9606.ENSP00000243108	0.639	Homeobox protein Hox-C6
10	9606.ENSP00000430497	0.630	Zinc finger homeobox protein 4
11	9606.ENSP00000342680	0.603	Uncharacterized protein CXorf67
12	9606.ENSP00000362125	0.602	Protocadherin-19
13	9606.ENSP00000307208	0.592	Nucleosome-remodeling factor subunit BPTF
14	9606.ENSP00000307321	0.562	Homeobox protein Hox-C10
15	9606.ENSP00000297857	0.536	Zinc fingers and homeoboxes protein 1
16	9606.ENSP00000309336	0.529	Homeobox protein Hox-C5
17	9606.ENSP00000374240	0.521	Short stature homeobox protein 2
18	9606.ENSP00000239461	0.519	Paired mesoderm homeobox protein 1
19	9606.ENSP00000270722	0.518	PR domain zinc finger protein 16
20	9606.ENSP00000341551	0.515	Mothers against decapentaplegic homolog 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:1990837	0.991	sequence-specific double-stranded DNA binding
GO:0005515	0.980	protein binding
GO:0003700	0.980	DNA-binding transcription factor activity
GO:0000981	0.941	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.894	transcription cis-regulatory region binding
GO:0000977	0.750	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.989	developmental process
GO:0050794	0.985	regulation of cellular process
GO:0032501	0.984	multicellular organismal process
GO:0048856	0.976	anatomical structure development
GO:0019222	0.942	regulation of metabolic process
GO:0007275	0.933	multicellular organism development
GO:0060255	0.925	regulation of macromolecule metabolic process
GO:0010468	0.916	regulation of gene expression
GO:0006355	0.902	regulation of DNA-templated transcription
GO:0006357	0.880	regulation of transcription by RNA polymerase II
GO:0048731	0.853	system development
GO:0048513	0.742	animal organ development
GO:0009987	0.733	cellular process
GO:0048519	0.711	negative regulation of biological process
GO:0009892	0.597	negative regulation of metabolic process
GO:0048523	0.547	negative regulation of cellular process
GO:0010605	0.502	negative regulation of macromolecule metabolic process
GO:0051172	0.491	negative regulation of nitrogen compound metabolic process
GO:0031324	0.491	negative regulation of cellular metabolic process
GO:0001501	0.432	skeletal system development
GO:0048518	0.395	positive regulation of biological process
GO:0045934	0.382	negative regulation of nucleobase-containing compound metabolic process
GO:0048522	0.379	positive regulation of cellular process
GO:0031327	0.375	negative regulation of cellular biosynthetic process
GO:0010558	0.364	negative regulation of macromolecule biosynthetic process
GO:0051253	0.357	negative regulation of RNA metabolic process
GO:0007389	0.348	pattern specification process
GO:0045892	0.337	negative regulation of DNA-templated transcription
GO:0010604	0.305	positive regulation of macromolecule metabolic process
GO:0051173	0.304	positive regulation of nitrogen compound metabolic process
GO:0031325	0.304	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.370	cytoplasm
GO:0043232	0.331	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]