StarFunc result for job id P31274

User Input

>input (260 residues)
MSATGPISNYYVDSLISHDNEDLLASRFPATGAHPAAARPSGLVPDCSDFPSCSFAPKPA
VFSTSWAPVPSQSSVVYHPYGPQPHLGADTRYMRTWLEPLSGAVSFPSFPAGGRHYALKP
DAYPGRRADCGPGEGRSYPDYMYGSPGELRDRAPQTLPSPEADALAGSKHKEEKADLDPS
NPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWF
QNRRMKMKKMNKEKTDKEQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RAZ6	0.343	0.343	1.667E-37	260	1.000	1.000	A0A024RAZ6.pdb.gz
2	AFDB:Q9YGS6	0.532	0.532	2.448E-27	260	0.719	0.719	Q9YGS6.pdb.gz	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
3	AFDB:P09021	0.272	0.262	4.350E-8	270	0.292	0.281	P09021.pdb.gz	HXA5_MOUSE Homeobox protein Hox-A5 OS=Mus musculus OX=10090 GN=Hoxa5 PE=1 SV=1
4	AFDB:P09067	0.274	0.266	1.046E-7	269	0.296	0.286	P09067.pdb.gz	HXB5_HUMAN Homeobox protein Hox-B5 OS=Homo sapiens OX=9606 GN=HOXB5 PE=1 SV=3
5	AFDB:P09077	0.274	0.177	1.465E-7	417	0.308	0.192	P09077.pdb.gz	SCR_DROME Homeotic protein Sex combs reduced OS=Drosophila melanogaster OX=7227 GN=Scr PE=1 SV=5
6	AFDB:P32442	0.226	0.232	1.465E-7	253	0.254	0.261	P32442.pdb.gz	MEOX1_MOUSE Homeobox protein MOX-1 OS=Mus musculus OX=10090 GN=Meox1 PE=1 SV=1
7	AFDB:A3KNJ6	0.255	0.219	1.567E-7	307	0.281	0.238	A3KNJ6.pdb.gz	A3KNJ6_DANRE Homeo box B1b OS=Danio rerio OX=7955 GN=cb249 PE=2 SV=1
8	AFDB:P14653	0.256	0.223	3.292E-7	301	0.288	0.249	P14653.pdb.gz	HXB1_HUMAN Homeobox protein Hox-B1 OS=Homo sapiens OX=9606 GN=HOXB1 PE=1 SV=2
9	AFDB:P31275	0.270	0.249	6.463E-7	282	0.285	0.262	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
10	AFDB:P50221	0.244	0.249	7.397E-7	254	0.254	0.260	P50221.pdb.gz	MEOX1_HUMAN Homeobox protein MOX-1 OS=Homo sapiens OX=9606 GN=MEOX1 PE=1 SV=1
11	PDB:4egcA	0.179	0.090	1.249E-2	539	0.073	0.035	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.198	0.615	2.272E-1	73	0.062	0.219	2hi3A.pdb.gz
13	PDB:5nr5A	0.147	0.311	1.227	113	0.050	0.115	5nr5A.pdb.gz
14	PDB:7fbyA	0.144	0.228	1.313	153	0.031	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:4ldzA	0.151	0.189	2.252	196	0.062	0.082	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:5x6cA	0.125	0.068	2.252	539	0.038	0.019	5x6cA.pdb.gz	Structural basis for tRNA-dependent cysteine biosynthesis
17	PDB:5aj0BZ	0.157	0.406	2.949	86	0.046	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:5mrca	0.137	0.189	3.155	177	0.085	0.124	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:7w59R	0.112	0.104	3.155	280	0.077	0.071	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
20	PDB:1l3lB	0.128	0.140	3.375	233	0.054	0.060	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09633	0.0	540	260	0.996	0.996	HXC9_MOUSE Homeobox protein Hox-C9 OS=Mus musculus OX=10090 GN=Hoxc9 PE=2 SV=2
2	P31274	0.0	541	260	1.000	1.000	HXC9_HUMAN Homeobox protein Hox-C9 OS=Homo sapiens OX=9606 GN=HOXC9 PE=1 SV=3
3	Q9YGS6	3.12e-128	365	260	0.665	0.665	HXC9A_DANRE Homeobox protein Hox-C9a OS=Danio rerio OX=7955 GN=hoxc9a PE=2 SV=2
4	D3ZSU5	7.25e-74	228	271	0.523	0.502	D3ZSU5_RAT Homeobox protein OS=Rattus norvegicus OX=10116 GN=Hoxa9 PE=3 SV=1
5	P20615	1.11e-73	227	250	0.515	0.536	HXB9_MOUSE Homeobox protein Hox-B9 OS=Mus musculus OX=10090 GN=Hoxb9 PE=2 SV=3
6	P09631	7.51e-73	225	271	0.519	0.498	HXA9_MOUSE Homeobox protein Hox-A9 OS=Mus musculus OX=10090 GN=Hoxa9 PE=1 SV=2
7	P17482	1.68e-72	224	250	0.508	0.528	HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2
8	P31269	6.88e-72	223	272	0.515	0.493	HXA9_HUMAN Homeobox protein Hox-A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=4
9	P28356	1.38e-67	214	352	0.558	0.412	HXD9_HUMAN Homeobox protein Hox-D9 OS=Homo sapiens OX=9606 GN=HOXD9 PE=1 SV=5
10	P28357	3.83e-65	208	339	0.554	0.425	HXD9_MOUSE Homeobox protein Hox-D9 OS=Mus musculus OX=10090 GN=Hoxd9 PE=2 SV=1
11	A0A669K9T0	1.64e-55	179	225	0.446	0.516	A0A669K9T0_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
12	A0A669KBC8	6.07e-47	157	213	0.269	0.329	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
13	Q53XI4	2.59e-38	139	342	0.292	0.222	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
14	Q9NYD6	2.59e-38	139	342	0.292	0.222	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
15	P31257	4.03e-38	138	342	0.327	0.249	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
16	P28358	1.77e-37	136	340	0.254	0.194	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
17	P28359	5.51e-37	135	340	0.250	0.191	HXD10_MOUSE Homeobox protein Hox-D10 OS=Mus musculus OX=10090 GN=Hoxd10 PE=1 SV=2
18	P31260	8.05e-37	136	410	0.265	0.168	HXA10_HUMAN Homeobox protein Hox-A10 OS=Homo sapiens OX=9606 GN=HOXA10 PE=1 SV=3
19	P31310	2.73e-36	135	416	0.242	0.151	HXA10_MOUSE Homeobox protein Hox-A10 OS=Mus musculus OX=10090 GN=Hoxa10 PE=1 SV=4
20	P31267	5.62e-26	103	233	0.212	0.236	HXA6_HUMAN Homeobox protein Hox-A6 OS=Homo sapiens OX=9606 GN=HOXA6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	2.8e-17	73.6	Homeodomain
2	PF04617 Hox9_act	2.7e-57	205.7	Hox9 activation region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000006142

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002289	0.769	PBX homeobox 2
2	9593.ENSGGOP00000008823	0.769	PBX homeobox 3
3	9593.ENSGGOP00000011021	0.769	PBX homeobox 1
4	9593.ENSGGOP00000009360	0.717	Geminin, DNA replication inhibitor
5	9593.ENSGGOP00000028071	0.661	Forkhead box P1
6	9593.ENSGGOP00000013440	0.577	T-box 5
7	9593.ENSGGOP00000013563	0.577	T-box 4
8	9593.ENSGGOP00000017439	0.577	Short stature homeobox 2
9	9593.ENSGGOP00000015822	0.571	Mohawk homeobox
10	9593.ENSGGOP00000006145	0.559	Homeobox C8
11	9593.ENSGGOP00000001078	0.544	Meis homeobox 3
12	9593.ENSGGOP00000005333	0.544	Meis homeobox 1
13	9593.ENSGGOP00000006646	0.544	Meis homeobox 2
14	9593.ENSGGOP00000003533	0.519	Transmembrane protein 26
15	9593.ENSGGOP00000001602	0.506	Homeobox C6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.989	DNA-binding transcription factor activity
GO:0000976	0.980	transcription cis-regulatory region binding
GO:0000977	0.967	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.953	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.311	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.995	developmental process
GO:0048731	0.990	system development
GO:0009790	0.983	embryo development
GO:0007389	0.981	pattern specification process
GO:0001501	0.981	skeletal system development
GO:0048513	0.971	animal organ development
GO:0048706	0.965	embryonic skeletal system development
GO:0050789	0.959	regulation of biological process
GO:0050794	0.951	regulation of cellular process
GO:0009653	0.934	anatomical structure morphogenesis
GO:0048568	0.904	embryonic organ development
GO:0009952	0.849	anterior/posterior pattern specification
GO:0019222	0.794	regulation of metabolic process
GO:0010468	0.780	regulation of gene expression
GO:0010556	0.777	regulation of macromolecule biosynthetic process
GO:0031326	0.777	regulation of cellular biosynthetic process
GO:0051252	0.777	regulation of RNA metabolic process
GO:2001141	0.740	regulation of RNA biosynthetic process
GO:0006355	0.726	regulation of DNA-templated transcription
GO:0048518	0.705	positive regulation of biological process
GO:0009887	0.678	animal organ morphogenesis
GO:0048705	0.661	skeletal system morphogenesis
GO:0048704	0.633	embryonic skeletal system morphogenesis
GO:0009987	0.567	cellular process
GO:0048522	0.463	positive regulation of cellular process
GO:0006357	0.463	regulation of transcription by RNA polymerase II
GO:0010604	0.405	positive regulation of macromolecule metabolic process
GO:0051173	0.394	positive regulation of nitrogen compound metabolic process
GO:0051254	0.376	positive regulation of RNA metabolic process
GO:0031328	0.356	positive regulation of cellular biosynthetic process
GO:0045893	0.354	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.954	protein-containing complex
GO:0016234	0.824	inclusion body
GO:0016235	0.814	aggresome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]