StarFunc result for job id P31275

User Input

>input (282 residues)
MGEHNLLNPGFVGPLVNIHTGDTFYFPNFRASGAQLPGLPSLSYPRRDNVCSLSWPSAEP
CNGYPQPYLGSPVSLNPPFGRTCELARVEDGKGYYREPCAEGGGGGLKREERGRDPGAGP
GAALLPLEPSGPPALGFKYDYAAGGGGGDGGGGAGPPHDPPSCQSLESDSSSSLLNEGNK
GAGAGDPGSLVSPLNPGGGLSASGAPWYPINSRSRKKRKPYSKLQLAELEGEFLVNEFIT
RQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLLLREQALSFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31275	0.999	0.999	1.085E-39	282	1.000	1.000	P31275.pdb.gz	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
2	AFDB:P23812	0.307	0.321	8.010E-15	268	0.433	0.455	P23812.pdb.gz	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
3	AFDB:P79724	0.243	0.238	3.593E-7	289	0.262	0.256	P79724.pdb.gz	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
4	AFDB:P09632	0.277	0.318	1.045E-6	243	0.213	0.247	P09632.pdb.gz	HXB8_MOUSE Homeobox protein Hox-B8 OS=Mus musculus OX=10090 GN=Hoxb8 PE=1 SV=2
5	AFDB:P48031	0.220	0.180	2.844E-6	348	0.262	0.213	P48031.pdb.gz	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
6	AFDB:A2RU54	0.256	0.264	3.250E-6	273	0.209	0.216	A2RU54.pdb.gz	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
7	AFDB:Q8AXK9	0.223	0.184	7.240E-6	342	0.213	0.175	Q8AXK9.pdb.gz
8	AFDB:P49639	0.242	0.208	1.411E-5	335	0.238	0.200	P49639.pdb.gz	HXA1_HUMAN Homeobox protein Hox-A1 OS=Homo sapiens OX=9606 GN=HOXA1 PE=1 SV=2
9	AFDB:Q6ZNG2	0.224	0.188	1.411E-5	339	0.209	0.174	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
10	AFDB:O70137	0.210	0.174	2.407E-5	343	0.188	0.155	O70137.pdb.gz	ALX3_MOUSE Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1
11	PDB:4egcA	0.165	0.087	1.577E-2	539	0.046	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.178	0.592	1.022E-1	73	0.046	0.178	2hi3A.pdb.gz
13	PDB:5nr5A	0.123	0.275	4.149E-1	113	0.067	0.168	5nr5A.pdb.gz
14	PDB:7fbyA	0.133	0.225	4.149E-1	153	0.032	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:4ldzA	0.146	0.198	1.576	196	0.028	0.041	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:5aj0BZ	0.137	0.382	2.059	86	0.043	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:2cg4A	0.128	0.222	2.201	149	0.035	0.067	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
18	PDB:5mrca	0.130	0.195	2.353	177	0.050	0.079	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:7dcoL	0.126	0.085	2.353	435	0.053	0.034	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:2cyyA	0.140	0.247	3.285	151	0.025	0.046	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31275	0.0	561	282	1.000	1.000	HXC12_HUMAN Homeobox protein Hox-C12 OS=Homo sapiens OX=9606 GN=HOXC12 PE=3 SV=2
2	P23812	5.11e-53	175	268	0.450	0.474	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
3	P35452	1.08e-50	169	270	0.443	0.463	HXD12_HUMAN Homeobox protein Hox-D12 OS=Homo sapiens OX=9606 GN=HOXD12 PE=1 SV=3
4	O43248	2.30e-19	87.8	304	0.319	0.296	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
5	P31313	4.72e-19	87.0	304	0.135	0.125	HXC11_MOUSE Homeobox protein Hox-C11 OS=Mus musculus OX=10090 GN=Hoxc11 PE=2 SV=3
6	Q9XW88	7.36e-19	85.9	275	0.152	0.156	PHP3_CAEEL Homeobox protein php-3 OS=Caenorhabditis elegans OX=6239 GN=php-3 PE=2 SV=2
7	Q6W990	2.04e-18	85.5	310	0.124	0.113	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
8	P20615	2.27e-18	84.3	250	0.135	0.152	HXB9_MOUSE Homeobox protein Hox-B9 OS=Mus musculus OX=10090 GN=Hoxb9 PE=2 SV=3
9	P31277	2.37e-18	85.5	338	0.135	0.112	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3
10	P23813	2.56e-18	85.5	323	0.135	0.118	HXD11_MOUSE Homeobox protein Hox-D11 OS=Mus musculus OX=10090 GN=Hoxd11 PE=2 SV=2
11	P17482	2.61e-18	84.0	250	0.135	0.152	HXB9_HUMAN Homeobox protein Hox-B9 OS=Homo sapiens OX=9606 GN=HOXB9 PE=1 SV=2
12	P79724	3.74e-18	84.3	289	0.124	0.121	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
13	Q53XI4	4.04e-18	85.1	342	0.131	0.108	Q53XI4_HUMAN Homeo box C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=2 SV=1
14	Q9NYD6	4.04e-18	85.1	342	0.131	0.108	HXC10_HUMAN Homeobox protein Hox-C10 OS=Homo sapiens OX=9606 GN=HOXC10 PE=1 SV=2
15	P31257	4.77e-18	84.7	342	0.131	0.108	HXC10_MOUSE Homeobox protein Hox-C10 OS=Mus musculus OX=10090 GN=Hoxc10 PE=2 SV=1
16	P09087	6.22e-18	85.5	493	0.128	0.073	ABDB_DROME Homeobox protein abdominal-B OS=Drosophila melanogaster OX=7227 GN=Abd-B PE=1 SV=3
17	P28359	8.03e-18	84.0	340	0.131	0.109	HXD10_MOUSE Homeobox protein Hox-D10 OS=Mus musculus OX=10090 GN=Hoxd10 PE=1 SV=2
18	A0A669KBC8	8.18e-18	82.0	213	0.167	0.221	A0A669KBC8_HUMAN Homeobox A9 OS=Homo sapiens OX=9606 GN=HOXA9 PE=1 SV=1
19	P28358	9.22e-18	84.0	340	0.131	0.109	HXD10_HUMAN Homeobox protein Hox-D10 OS=Homo sapiens OX=9606 GN=HOXD10 PE=1 SV=2
20	D4ACD0	9.40e-18	84.0	339	0.124	0.103	D4ACD0_RAT Homeo box D13 OS=Rattus norvegicus OX=10116 GN=Hoxd13 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	27	16.1	Homeobox KN domain
2	PF00046 Homeodomain	6.7e-15	66.0	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225899	0.693	Keratin, type I cuticular Ha2
2	9606.ENSP00000377558	0.565	Keratin, type I cuticular Ha5
3	9606.ENSP00000226247	0.534	Forkhead box protein N1
4	9606.ENSP00000243056	0.526	Homeobox protein Hox-C13
5	9606.ENSP00000320147	0.504	Histone-lysine N-methyltransferase EZH2
6	9606.ENSP00000383042	0.502	Lysine-specific histone demethylase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.951	DNA-binding transcription factor activity
GO:0005515	0.948	protein binding
GO:0000981	0.893	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.501	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.982	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0048856	0.956	anatomical structure development
GO:0019222	0.890	regulation of metabolic process
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0010468	0.874	regulation of gene expression
GO:0006355	0.815	regulation of DNA-templated transcription
GO:0031325	0.773	positive regulation of cellular metabolic process
GO:0032501	0.663	multicellular organismal process
GO:0009987	0.593	cellular process
GO:0009891	0.517	positive regulation of biosynthetic process
GO:0006357	0.476	regulation of transcription by RNA polymerase II
GO:0010604	0.465	positive regulation of macromolecule metabolic process
GO:0051173	0.464	positive regulation of nitrogen compound metabolic process
GO:0007275	0.446	multicellular organism development
GO:0051254	0.435	positive regulation of RNA metabolic process
GO:0010557	0.433	positive regulation of macromolecule biosynthetic process
GO:1902680	0.377	positive regulation of RNA biosynthetic process
GO:1903508	0.327	positive regulation of nucleic acid-templated transcription
GO:0045893	0.323	positive regulation of DNA-templated transcription
GO:0048731	0.315	system development
GO:0009653	0.309	anatomical structure morphogenesis
GO:0048513	0.305	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.737	cytoplasm
GO:0043232	0.528	intracellular non-membrane-bounded organelle
GO:0005829	0.436	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]