StarFunc result for job id P31276

User Input

>input (330 residues)
MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGL
GSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLG
YGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDLSSRAKEFAFYPSFAS
SYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYCSKEQSQSAHLW
KSPFPDVVPLQPEVSSYRRGRKKRVPYTKVQLKELEKEYAASKFITKEKRRRISATTNLS
ERQVTIWFQNRRVKEKKVVSKSKAPHLHST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31276	0.999	0.999	1.142E-45	330	1.000	1.000	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
2	AFDB:B2RYB5	0.200	0.211	1.762E-6	313	0.248	0.262	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
3	AFDB:P82976	0.212	0.169	2.325E-5	418	0.242	0.191	P82976.pdb.gz	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2
4	AFDB:Q5U1D9	0.201	0.084	1.025E-4	837	0.161	0.063	Q5U1D9.pdb.gz	Q5U1D9_DROME SD09647p OS=Drosophila melanogaster OX=7227 GN=Vsx1 PE=2 SV=1
5	PDB:4egcA	0.153	0.094	2.593E-2	539	0.039	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
6	PDB:2hi3A	0.147	0.560	3.147E-2	73	0.045	0.205	2hi3A.pdb.gz
7	AFDB:Q80W88	0.184	0.115	4.128E-2	542	0.161	0.098	Q80W88.pdb.gz	HOMEZ_MOUSE Homeobox and leucine zipper protein Homez OS=Mus musculus OX=10090 GN=Homez PE=1 SV=2
8	AFDB:Q8IX15	0.172	0.108	4.403E-2	550	0.161	0.096	Q8IX15.pdb.gz	HOMEZ_HUMAN Homeobox and leucine zipper protein Homez OS=Homo sapiens OX=9606 GN=HOMEZ PE=1 SV=2
9	AFDB:O08755	0.183	0.134	2.512E-1	465	0.215	0.153	O08755.pdb.gz	HNF6_MOUSE Hepatocyte nuclear factor 6 OS=Mus musculus OX=10090 GN=Onecut1 PE=1 SV=1
10	AFDB:Q8VIH1	0.189	0.122	5.811E-1	527	0.155	0.097	Q8VIH1.pdb.gz	NOBOX_MOUSE Homeobox protein NOBOX OS=Mus musculus OX=10090 GN=Nobox PE=1 SV=1
11	PDB:7fbyA	0.121	0.230	6.115E-1	153	0.039	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
12	PDB:5aj0BZ	0.104	0.290	1.166	86	0.045	0.174	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
13	PDB:5z56L	0.135	0.131	1.166	342	0.024	0.023	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:2cyyA	0.118	0.229	1.509	151	0.045	0.099	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
15	AFDB:P91621	0.087	0.018	1.631	2072	0.158	0.025	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
16	PDB:3ndbB	0.145	0.116	1.831	420	0.036	0.029	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
17	AFDB:E7F5M0	0.086	0.030	1.855	1218	0.188	0.051	E7F5M0.pdb.gz
18	PDB:5nr5A	0.127	0.329	2.370	113	0.045	0.133	5nr5A.pdb.gz
19	PDB:2cg4A	0.113	0.217	2.527	149	0.012	0.027	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:2cjjA	0.147	0.589	2.527	63	0.030	0.159	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31276	0.0	672	330	1.000	1.000	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
2	P50207	0.0	656	328	0.982	0.988	HXC13_MOUSE Homeobox protein Hox-C13 OS=Mus musculus OX=10090 GN=Hoxc13 PE=2 SV=2
3	Q6JIY5	3.67e-171	479	306	0.712	0.768	HXCDA_DANRE Homeobox protein Hox-C13a OS=Danio rerio OX=7955 GN=hoxc13a PE=2 SV=1
4	Q6JIY4	3.21e-138	394	273	0.585	0.707	HXCDB_DANRE Homeobox protein Hox-C13b OS=Danio rerio OX=7955 GN=hoxc13b PE=2 SV=1
5	P79724	5.39e-90	272	289	0.485	0.554	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
6	Q6W990	7.27e-88	268	310	0.509	0.542	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
7	P35453	1.05e-81	253	343	0.421	0.405	HXD13_HUMAN Homeobox protein Hox-D13 OS=Homo sapiens OX=9606 GN=HOXD13 PE=1 SV=3
8	D4ACD0	2.91e-81	252	339	0.391	0.381	D4ACD0_RAT Homeo box D13 OS=Rattus norvegicus OX=10116 GN=Hoxd13 PE=3 SV=3
9	P70217	2.91e-81	252	339	0.391	0.381	HXD13_MOUSE Homeobox protein Hox-D13 OS=Mus musculus OX=10090 GN=Hoxd13 PE=1 SV=2
10	P31271	6.60e-75	237	388	0.424	0.361	HXA13_HUMAN Homeobox protein Hox-A13 OS=Homo sapiens OX=9606 GN=HOXA13 PE=1 SV=3
11	A0A0G2K6K0	3.42e-74	235	386	0.421	0.360	A0A0G2K6K0_RAT Homeo box A13 OS=Rattus norvegicus OX=10116 GN=Hoxa13 PE=3 SV=2
12	Q62424	3.42e-74	235	386	0.421	0.360	HXA13_MOUSE Homeobox protein Hox-A13 OS=Mus musculus OX=10090 GN=Hoxa13 PE=1 SV=1
13	P70321	3.90e-65	209	286	0.394	0.455	HXB13_MOUSE Homeobox protein Hox-B13 OS=Mus musculus OX=10090 GN=Hoxb13 PE=2 SV=1
14	D3ZWL5	6.34e-65	208	286	0.394	0.455	D3ZWL5_RAT Homeo box B13 OS=Rattus norvegicus OX=10116 GN=Hoxb13 PE=3 SV=1
15	Q92826	1.49e-64	207	284	0.385	0.447	HXB13_HUMAN Homeobox protein Hox-B13 OS=Homo sapiens OX=9606 GN=HOXB13 PE=1 SV=2
16	P23812	5.96e-19	87.0	268	0.112	0.138	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
17	P35452	8.63e-19	86.7	270	0.112	0.137	HXD12_HUMAN Homeobox protein Hox-D12 OS=Homo sapiens OX=9606 GN=HOXD12 PE=1 SV=3
18	P31270	1.62e-18	86.7	313	0.118	0.125	HXA11_HUMAN Homeobox protein Hox-A11 OS=Homo sapiens OX=9606 GN=HOXA11 PE=2 SV=2
19	G3V6Z0	2.39e-18	86.3	313	0.112	0.118	G3V6Z0_RAT Homeobox A11 OS=Rattus norvegicus OX=10116 GN=Hoxa11 PE=3 SV=1
20	P31311	2.49e-18	86.3	313	0.112	0.118	HXA11_MOUSE Homeobox protein Hox-A11 OS=Mus musculus OX=10090 GN=Hoxa11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	2.5	19.4	Homeobox KN domain
2	PF00046 Homeodomain	7.4e-15	65.9	Homeodomain
3	PF12284 HoxA13_N	9.6e-31	118.3	Hox protein A13 N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000226247	0.745	Forkhead box protein N1
2	9606.ENSP00000446680	0.656	Homeobox protein Hox-C11
3	9606.ENSP00000257951	0.628	Keratin, type II cuticular Hb4
4	9606.ENSP00000296839	0.619	Forkhead box protein Q1
5	9606.ENSP00000225899	0.607	Keratin, type I cuticular Ha2
6	9606.ENSP00000307321	0.577	Homeobox protein Hox-C10
7	9606.ENSP00000340454	0.577	Rap1 GTPase-GDP dissociation stimulator 1
8	9606.ENSP00000314348	0.576	Probable ATP-dependent RNA helicase DDX10
9	9606.ENSP00000370109	0.576	PC4 and SFRS1-interacting protein
10	9606.ENSP00000313983	0.557	Histone-lysine N-methyltransferase NSD3
11	9606.ENSP00000251645	0.556	Keratin, type I cuticular Ha1
12	9606.ENSP00000282030	0.553	SET binding protein 1
13	9606.ENSP00000316032	0.545	Nuclear pore complex protein Nup98-Nup96
14	9606.ENSP00000348381	0.538	Gamma-adducin
15	9606.ENSP00000265165	0.537	Lymphoid enhancer-binding factor 1
16	9606.ENSP00000322579	0.535	PHD finger protein 23
17	9606.ENSP00000239461	0.532	Paired mesoderm homeobox protein 1
18	9606.ENSP00000243103	0.526	Homeobox protein Hox-C12
19	9606.ENSP00000257901	0.518	Keratin, type II cuticular Hb5
20	9606.ENSP00000226067	0.515	Hepatic leukemia factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0000981	0.936	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0140297	0.921	DNA-binding transcription factor binding
GO:0001216	0.703	DNA-binding transcription activator activity
GO:0001228	0.686	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000977	0.452	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.991	developmental process
GO:0050789	0.988	regulation of biological process
GO:0048856	0.984	anatomical structure development
GO:0050794	0.984	regulation of cellular process
GO:0019222	0.968	regulation of metabolic process
GO:0009889	0.958	regulation of biosynthetic process
GO:0031323	0.918	regulation of cellular metabolic process
GO:0031326	0.911	regulation of cellular biosynthetic process
GO:0051171	0.907	regulation of nitrogen compound metabolic process
GO:0010468	0.907	regulation of gene expression
GO:0051252	0.895	regulation of RNA metabolic process
GO:0006355	0.891	regulation of DNA-templated transcription
GO:0048518	0.880	positive regulation of biological process
GO:0006357	0.859	regulation of transcription by RNA polymerase II
GO:0048522	0.847	positive regulation of cellular process
GO:0051254	0.836	positive regulation of RNA metabolic process
GO:0045893	0.830	positive regulation of DNA-templated transcription
GO:0032501	0.802	multicellular organismal process
GO:0009653	0.735	anatomical structure morphogenesis
GO:0007275	0.581	multicellular organism development
GO:0048513	0.476	animal organ development
GO:0009987	0.423	cellular process
GO:0045944	0.396	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031981	0.953	nuclear lumen
GO:0005654	0.935	nucleoplasm
GO:0005737	0.669	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]