StarFunc result for job id P31321

User Input

>input (381 residues)
MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKE
ENRQILARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P12849	0.776	0.776	7.018E-71	381	0.948	0.948	P12849.pdb.gz	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
2	AFDB:P09456	0.716	0.716	7.593E-61	381	0.816	0.816	P09456.pdb.gz	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
3	AFDB:P16905	0.694	0.702	7.074E-57	376	0.711	0.721	P16905.pdb.gz	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
4	AFDB:P30625	0.767	0.798	3.443E-54	366	0.556	0.579	P30625.pdb.gz	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
5	PDB:4dinB	0.723	0.796	3.584E-53	345	0.885	0.977	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
6	PDB:6byrB	0.732	0.962	5.643E-53	288	0.672	0.889	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
7	AFDB:P05987	0.657	0.756	1.906E-39	327	0.415	0.483	P05987.pdb.gz	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
8	AFDB:P81900	0.730	0.737	2.135E-39	377	0.375	0.379	P81900.pdb.gz	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
9	AFDB:P13861	0.716	0.677	1.557E-38	404	0.360	0.339	P13861.pdb.gz	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
10	AFDB:P12367	0.720	0.686	3.256E-38	401	0.365	0.347	P12367.pdb.gz	KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2
11	AFDB:A9C3T0	0.679	0.655	1.940E-36	397	0.354	0.340	A9C3T0.pdb.gz	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
12	AFDB:P31322	0.667	0.612	2.053E-36	418	0.388	0.354	P31322.pdb.gz	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
13	PDB:3j4qB	0.694	0.692	5.472E-36	382	0.346	0.346	3j4qB.pdb.gz
14	PDB:5dykA	0.596	0.291	2.922E-27	809	0.234	0.110	5dykA.pdb.gz
15	PDB:6wjfC	0.656	0.831	5.455E-27	295	0.323	0.417	6wjfC.pdb.gz
16	PDB:2byvE	0.250	0.110	2.647E-15	922	0.176	0.073	2byvE.pdb.gz
17	PDB:4f7zA	0.258	0.112	1.373E-14	946	0.163	0.066	4f7zA.pdb.gz
18	PDB:4byyA	0.302	0.485	2.610E-11	226	0.092	0.155	4byyA.pdb.gz
19	PDB:3i54D	0.269	0.425	3.884E-11	228	0.102	0.171	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
20	PDB:4ev0D	0.276	0.459	1.469E-9	214	0.076	0.136	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P00514	0.0	659	380	0.816	0.818	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
2	P07802	0.0	655	380	0.816	0.818	KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa OX=9823 GN=PRKAR1A PE=1 SV=2
3	P09456	0.0	664	381	0.827	0.827	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
4	P10644	0.0	655	381	0.814	0.814	KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1
5	P12849	0.0	751	381	0.948	0.948	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
6	P16905	0.0	560	376	0.714	0.723	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
7	P31321	0.0	786	381	1.000	1.000	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4
8	P81377	0.0	751	381	0.948	0.948	KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1b PE=2 SV=2
9	Q9DBC7	0.0	661	381	0.824	0.824	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3
10	P30625	1.31e-147	424	366	0.556	0.579	KAPR_CAEEL cAMP-dependent protein kinase regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=kin-2 PE=1 SV=3
11	P05987	1.23e-102	308	327	0.407	0.474	KAPR_DICDI cAMP-dependent protein kinase regulatory subunit OS=Dictyostelium discoideum OX=44689 GN=pkaR PE=1 SV=1
12	P81900	3.89e-81	254	377	0.362	0.366	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
13	Q6DHZ2	8.15e-78	247	418	0.383	0.349	Q6DHZ2_HUMAN Protein kinase, cAMP-dependent, regulatory, type II, beta OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=1
14	P31323	9.68e-78	247	418	0.383	0.349	KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3
15	P12369	2.26e-77	246	416	0.381	0.349	KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3
16	P31322	6.01e-77	245	418	0.383	0.349	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
17	P31324	7.52e-77	245	416	0.381	0.349	KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2b PE=1 SV=3
18	P00515	1.94e-72	233	401	0.378	0.359	KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2
19	C1PIG4	5.14e-72	232	401	0.373	0.354	C1PIG4_PIG cAMP-dependent protein kinase regulatory subunit type II alpha OS=Sus scrofa OX=9823 GN=PRKAR2A PE=2 SV=1
20	P13861	7.38e-72	231	404	0.331	0.312	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	1.3e-37	139.0	Cyclic nucleotide-binding domain
2	PF02197 RIIa	1.4e-10	51.9	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385749

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309591	0.999	cAMP-dependent protein kinase catalytic subunit alpha
2	9606.ENSP00000359719	0.999	cAMP-dependent protein kinase catalytic subunit beta
3	9606.ENSP00000366488	0.997	cAMP-dependent protein kinase catalytic subunit gamma
4	9606.ENSP00000376475	0.975	cAMP-dependent protein kinase type I-alpha regulatory subunit
5	9606.ENSP00000265717	0.959	cAMP-dependent protein kinase type II-beta regulatory subunit
6	9606.ENSP00000387699	0.952	Cyclic AMP-responsive element-binding protein 1
7	9606.ENSP00000360141	0.951	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
8	9606.ENSP00000265372	0.937	cAMP responsive element modulator
9	9606.ENSP00000265563	0.932	cAMP-dependent protein kinase type II-alpha regulatory subunit
10	9606.ENSP00000481878	0.929	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
11	9606.ENSP00000215832	0.924	Mitogen-activated protein kinase 1
12	9606.ENSP00000263025	0.918	Mitogen-activated protein kinase 3
13	9606.ENSP00000262848	0.915	cAMP-dependent protein kinase catalytic subunit PRKX
14	9606.ENSP00000358490	0.915	T-cell surface antigen CD2
15	9606.ENSP00000305372	0.912	Beta-2 adrenergic receptor
16	9606.ENSP00000254079	0.911	Protein phosphatase 1 regulatory subunit 1B
17	9606.ENSP00000267257	0.910	Paxillin
18	9606.ENSP00000410452	0.910	Stathmin
19	9606.ENSP00000477999	0.908	Nitric oxide synthase, brain
20	9606.ENSP00000379350	0.907	Integrin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0034236	0.999	protein kinase A catalytic subunit binding
GO:0008603	0.997	cAMP-dependent protein kinase regulator activity
GO:0030291	0.825	protein serine/threonine kinase inhibitor activity
GO:1901363	0.585	heterocyclic compound binding
GO:0097159	0.583	organic cyclic compound binding
GO:0004862	0.550	cAMP-dependent protein kinase inhibitor activity
GO:0043167	0.376	ion binding
GO:0003824	0.353	catalytic activity
GO:0097367	0.352	carbohydrate derivative binding
GO:0000166	0.346	nucleotide binding
GO:0032555	0.342	purine ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0065009	0.990	regulation of molecular function
GO:0009987	0.984	cellular process
GO:0051174	0.984	regulation of phosphorus metabolic process
GO:0051338	0.979	regulation of transferase activity
GO:0031399	0.975	regulation of protein modification process
GO:0042325	0.971	regulation of phosphorylation
GO:0043549	0.947	regulation of kinase activity
GO:0001932	0.938	regulation of protein phosphorylation
GO:0048519	0.915	negative regulation of biological process
GO:0050896	0.908	response to stimulus
GO:0048523	0.886	negative regulation of cellular process
GO:0045859	0.879	regulation of protein kinase activity
GO:0010563	0.870	negative regulation of phosphorus metabolic process
GO:0032501	0.863	multicellular organismal process
GO:0051716	0.863	cellular response to stimulus
GO:0031400	0.861	negative regulation of protein modification process
GO:0051348	0.860	negative regulation of transferase activity
GO:0045936	0.860	negative regulation of phosphate metabolic process
GO:0006469	0.852	negative regulation of protein kinase activity
GO:0023051	0.848	regulation of signaling
GO:0010646	0.848	regulation of cell communication
GO:0048522	0.836	positive regulation of cellular process
GO:0008152	0.829	metabolic process
GO:0023052	0.801	signaling
GO:0071704	0.798	organic substance metabolic process
GO:0007154	0.796	cell communication
GO:0007165	0.767	signal transduction
GO:0071900	0.728	regulation of protein serine/threonine kinase activity
GO:0065008	0.693	regulation of biological quality
GO:0071901	0.683	negative regulation of protein serine/threonine kinase activity
GO:0044238	0.635	primary metabolic process
GO:0006807	0.592	nitrogen compound metabolic process
GO:0048583	0.554	regulation of response to stimulus
GO:0044237	0.545	cellular metabolic process
GO:0071840	0.504	cellular component organization or biogenesis
GO:0016043	0.455	cellular component organization
GO:0050804	0.400	modulation of chemical synaptic transmission
GO:0048856	0.377	anatomical structure development
GO:1901564	0.325	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:1902494	0.988	catalytic complex
GO:0140535	0.982	intracellular protein-containing complex
GO:1990234	0.979	transferase complex
GO:0005952	0.969	cAMP-dependent protein kinase complex
GO:0043227	0.954	membrane-bounded organelle
GO:0016020	0.878	membrane
GO:0005829	0.874	cytosol
GO:0071944	0.861	cell periphery
GO:0043229	0.717	intracellular organelle
GO:0043231	0.708	intracellular membrane-bounded organelle
GO:0042995	0.505	cell projection
GO:0120025	0.504	plasma membrane bounded cell projection
GO:0005886	0.429	plasma membrane
GO:0031982	0.314	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]