StarFunc result for job id P31323

User Input

>input (418 residues)
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31322	0.935	0.935	3.976E-76	418	0.974	0.974	P31322.pdb.gz	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
2	AFDB:A9C3T0	0.768	0.807	2.496E-57	397	0.670	0.705	A9C3T0.pdb.gz	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
3	AFDB:P13861	0.678	0.700	8.190E-55	404	0.653	0.676	P13861.pdb.gz	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
4	AFDB:P12367	0.707	0.734	6.802E-54	401	0.646	0.673	P12367.pdb.gz	KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2
5	PDB:3j4qB	0.629	0.685	6.204E-49	382	0.634	0.694	3j4qB.pdb.gz
6	AFDB:P81900	0.631	0.692	3.115E-42	377	0.431	0.477	P81900.pdb.gz	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
7	PDB:6wjfC	0.579	0.791	1.457E-40	295	0.691	0.980	6wjfC.pdb.gz
8	AFDB:P16905	0.651	0.719	5.238E-37	376	0.328	0.364	P16905.pdb.gz	KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R1 PE=1 SV=2
9	AFDB:P09456	0.666	0.727	1.994E-36	381	0.340	0.373	P09456.pdb.gz	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
10	AFDB:P12849	0.644	0.699	2.492E-36	381	0.368	0.404	P12849.pdb.gz	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
11	AFDB:Q9HEW1	0.612	0.558	4.772E-35	459	0.328	0.298	Q9HEW1.pdb.gz	KAPR_CANAL cAMP-dependent protein kinase regulatory subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BCY1 PE=3 SV=1
12	AFDB:A2R7J4	0.621	0.631	1.164E-34	411	0.340	0.345	A2R7J4.pdb.gz	A2R7J4_ASPNC cAMP-dependent protein kinase regulatory subunit OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pkaR PE=3 SV=1
13	PDB:6byrB	0.562	0.788	1.377E-31	288	0.309	0.448	6byrB.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
14	PDB:4dinB	0.581	0.690	3.295E-30	345	0.316	0.383	4dinB.pdb.gz	Localization and quaternary structure of the PKA RI Beta holoenzyme
15	PDB:5dykA	0.501	0.273	2.401E-22	809	0.187	0.096	5dykA.pdb.gz
16	PDB:2byvE	0.244	0.115	5.536E-16	922	0.136	0.062	2byvE.pdb.gz
17	PDB:4f7zA	0.248	0.115	8.175E-16	946	0.139	0.061	4f7zA.pdb.gz
18	PDB:3i54D	0.277	0.483	1.508E-9	228	0.072	0.132	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
19	PDB:4ev0D	0.272	0.505	1.686E-9	214	0.072	0.140	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
20	PDB:4orfA	0.270	0.343	2.355E-9	319	0.077	0.100	4orfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9C3T0	0.0	561	397	0.672	0.708	A9C3T0_DANRE Protein kinase, cAMP-dependent, regulatory, type II, alpha A OS=Danio rerio OX=7955 GN=wu:fb55f12 PE=1 SV=1
2	C1PIG4	0.0	555	401	0.663	0.691	C1PIG4_PIG cAMP-dependent protein kinase regulatory subunit type II alpha OS=Sus scrofa OX=9823 GN=PRKAR2A PE=2 SV=1
3	P00515	0.0	557	401	0.667	0.696	KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2A PE=1 SV=2
4	P12367	0.0	542	401	0.653	0.681	KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2a PE=1 SV=2
5	P12368	0.0	539	401	0.648	0.676	KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2a PE=1 SV=4
6	P12369	0.0	837	416	0.969	0.974	KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3
7	P13861	0.0	544	404	0.648	0.671	KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2
8	P31322	0.0	842	418	0.974	0.974	KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2
9	P31323	0.0	866	418	1.000	1.000	KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3
10	P31324	0.0	834	416	0.971	0.976	KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar2b PE=1 SV=3
11	Q08BH1	0.0	556	397	0.670	0.705	Q08BH1_DANRE Prkar2aa protein OS=Danio rerio OX=7955 GN=prkar2aa PE=2 SV=1
12	Q6DHZ2	0.0	862	418	0.998	0.998	Q6DHZ2_HUMAN Protein kinase, cAMP-dependent, regulatory, type II, beta OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=1
13	P81900	9.66e-117	347	377	0.431	0.477	KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2
14	P81377	1.46e-80	254	381	0.359	0.394	KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1b PE=2 SV=2
15	P31321	3.45e-80	254	381	0.356	0.391	KAP1_HUMAN cAMP-dependent protein kinase type I-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1B PE=1 SV=4
16	P12849	1.69e-79	252	381	0.356	0.391	KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1b PE=1 SV=2
17	P00514	3.14e-74	238	380	0.325	0.358	KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
18	P09456	4.40e-74	238	381	0.354	0.388	KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
19	P10644	5.01e-74	238	381	0.325	0.357	KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1
20	Q9DBC7	7.69e-74	237	381	0.325	0.357	KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00027 cNMP_binding	5.4e-33	124.3	Cyclic nucleotide-binding domain
2	PF02197 RIIa	1.8e-13	61.2	Regulatory subunit of type II PKA R-subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265717

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309591	0.999	cAMP-dependent protein kinase catalytic subunit alpha
2	9606.ENSP00000366488	0.999	cAMP-dependent protein kinase catalytic subunit gamma
3	9606.ENSP00000359719	0.998	cAMP-dependent protein kinase catalytic subunit beta
4	9606.ENSP00000378207	0.998	A-kinase anchor protein 5
5	9606.ENSP00000478212	0.997	A-kinase anchor protein 1, mitochondrial
6	9606.ENSP00000265563	0.987	cAMP-dependent protein kinase type II-alpha regulatory subunit
7	9606.ENSP00000348573	0.985	A-kinase anchor protein 9
8	9606.ENSP00000354718	0.962	A-kinase anchor protein 13
9	9606.ENSP00000387699	0.962	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000262848	0.961	cAMP-dependent protein kinase catalytic subunit PRKX
11	9606.ENSP00000385749	0.959	cAMP-dependent protein kinase type I-beta regulatory subunit
12	9606.ENSP00000376475	0.958	cAMP-dependent protein kinase type I-alpha regulatory subunit
13	9606.ENSP00000269701	0.949	A-kinase anchor protein 8
14	9606.ENSP00000360141	0.941	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
15	9606.ENSP00000360485	0.936	A-kinase anchor protein 14
16	9606.ENSP00000305372	0.935	Beta-2 adrenergic receptor
17	9606.ENSP00000353508	0.934	Microtubule-associated protein 2
18	9606.ENSP00000326031	0.933	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
19	9606.ENSP00000003084	0.931	Cystic fibrosis transmembrane conductance regulator
20	9606.ENSP00000481878	0.930	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.922	enzyme binding
GO:0008603	0.919	cAMP-dependent protein kinase regulator activity
GO:0019900	0.759	kinase binding
GO:0019901	0.753	protein kinase binding
GO:0051018	0.575	protein kinase A binding
GO:0097159	0.537	organic cyclic compound binding
GO:1901363	0.514	heterocyclic compound binding
GO:0034236	0.485	protein kinase A catalytic subunit binding
GO:0004862	0.331	cAMP-dependent protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.981	response to stimulus
GO:0009987	0.980	cellular process
GO:0065009	0.977	regulation of molecular function
GO:0051174	0.976	regulation of phosphorus metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0051338	0.967	regulation of transferase activity
GO:0001932	0.965	regulation of protein phosphorylation
GO:0045859	0.950	regulation of protein kinase activity
GO:0023052	0.942	signaling
GO:0051716	0.928	cellular response to stimulus
GO:0007154	0.909	cell communication
GO:0071900	0.850	regulation of protein serine/threonine kinase activity
GO:0071901	0.836	negative regulation of protein serine/threonine kinase activity
GO:0007165	0.817	signal transduction
GO:0071704	0.625	organic substance metabolic process
GO:0032501	0.578	multicellular organismal process
GO:0044238	0.555	primary metabolic process
GO:0044237	0.448	cellular metabolic process
GO:0048518	0.433	positive regulation of biological process
GO:0042221	0.412	response to chemical
GO:0010646	0.403	regulation of cell communication
GO:0048522	0.349	positive regulation of cellular process
GO:0023051	0.335	regulation of signaling
GO:0048583	0.313	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0016020	0.997	membrane
GO:0032991	0.995	protein-containing complex
GO:0120025	0.995	plasma membrane bounded cell projection
GO:0005829	0.995	cytosol
GO:0005634	0.990	nucleus
GO:1902494	0.988	catalytic complex
GO:0005886	0.987	plasma membrane
GO:0043232	0.985	intracellular non-membrane-bounded organelle
GO:0061695	0.977	transferase complex, transferring phosphorus-containing groups
GO:0140535	0.976	intracellular protein-containing complex
GO:0005952	0.972	cAMP-dependent protein kinase complex
GO:0005929	0.961	cilium
GO:0005576	0.960	extracellular region
GO:0030054	0.921	cell junction
GO:0031982	0.891	vesicle
GO:0005615	0.834	extracellular space
GO:0065010	0.825	extracellular membrane-bounded organelle
GO:0070062	0.819	extracellular exosome
GO:0097447	0.813	dendritic tree
GO:0030425	0.792	dendrite
GO:0097546	0.764	ciliary base
GO:0005856	0.752	cytoskeleton
GO:0098794	0.736	postsynapse
GO:0005815	0.399	microtubule organizing center
GO:0005813	0.349	centrosome
GO:0012505	0.309	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]