StarFunc result for job id P31327

User Input

>input (1500 residues)
MTRILTAFKVVRTLKTGFGFTNVTAHQKWKFSRPGIRLLSVKAQTAHIVLEDGTKMKGYS
FGHPSSVAGEVVFNTGLGGYPEAITDPAYKGQILTMANPIIGNGGAPDTTALDELGLSKY
LESNGIKVSGLLVLDYSKDYNHWLATKSLGQWLQEEKVPAIYGVDTRMLTKIIRDKGTML
GKIEFEGQPVDFVDPNKQNLIAEVSTKDVKVYGKGNPTKVVAVDCGIKNNVIRLLVKRGA
EVHLVPWNHDFTKMEYDGILIAGGPGNPALAEPLIQNVRKILESDRKEPLFGISTGNLIT
GLAAGAKTYKMSMANRGQNQPVLNITNKQAFITAQNHGYALDNTLPAGWKPLFVNVNDQT
NEGIMHESKPFFAVQFHPEVTPGPIDTEYLFDSFFSLIKKGKATTITSVLPKPALVASRV
EVSKVLILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQAD
TVYFLPITPQFVTEVIKAEQPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVES
IMATEDRQLFSDKLNEINEKIAPSFAVESIEDALKAADTIGYPVMIRSAYALGGLGSGIC
PNRETLMDLSTKAFAMTNQILVEKSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHT
GDSVVVAPAQTLSNAEFQMLRRTSINVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLS
RSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLDR
FHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSIEGFTPRLPMNKEWPSNLDLR
KELSEPSSTRIYAIAKAIDDNMSLDEIEKLTYIDKWFLYKMRDILNMEKTLKGLNSESMT
EETLKRAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTNYLYV
TYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNCNPETV
STDFDECDKLYFEELSLERILDIYHQEACGGCIISVGGQIPNNLAVPLYKNGVKIMGTSP
LQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFAKSVDYPCLLRPSYVLSGSAMN
VVFSEDEMKKFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKDGRVISHAISEHVEDAG
VHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDVLVIECNLRA
SRSFPFVSKTLGVDFIDVATKVMIGENVDEKHLPTLDHPIIPADYVAIKAPMFSWPRLRD
ADPILRCEMASTGEVACFGEGIHTAFLKAMLSTGFKIPQKGILIGIQQSFRPRFLGVAEQ
LHNEGFKLFATEATSDWLNANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPN
NNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1bxrA	0.687	0.956	0.000	1073	0.291	0.407	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
2	PDB:5douD	0.951	0.998	0.000	1430	0.951	0.998	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
3	PDB:6uelA	0.865	0.972	0.000	1333	0.881	0.991	6uelA.pdb.gz	Small Molecule Inhibition of CPS1 Activity through an Allosteric Pocket.
4	PDB:6w2jB	0.887	0.975	0.000	1364	0.903	0.993	6w2jB.pdb.gz	Discovery of 2,6-Dimethylpiperazines as Allosteric Inhibitors of CPS1.
5	AFDB:A0A2R8Q0M3	0.971	0.963	0.000	1512	0.719	0.714	A0A2R8Q0M3.pdb.gz
6	AFDB:B2RQC6	0.928	0.627	0.000	2225	0.495	0.334	B2RQC6.pdb.gz	PYR1_MOUSE CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1
7	AFDB:D4A8A0	0.929	0.628	0.000	2224	0.498	0.336	D4A8A0.pdb.gz	D4A8A0_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=3
8	AFDB:O93937	0.927	0.614	0.000	2275	0.520	0.343	O93937.pdb.gz	PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pyrABCN PE=3 SV=2
9	AFDB:O94313	0.691	0.891	0.000	1160	0.382	0.494	O94313.pdb.gz	CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg4 PE=3 SV=1
10	AFDB:P00968	0.685	0.954	0.000	1073	0.289	0.404	P00968.pdb.gz	CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) OX=83333 GN=carB PE=1 SV=2
11	AFDB:P03965	0.692	0.925	0.000	1118	0.375	0.503	P03965.pdb.gz	CARB_YEAST Carbamoyl-phosphate synthase arginine-specific large chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPA2 PE=1 SV=1
12	AFDB:P05990	0.937	0.634	0.000	2224	0.494	0.333	P05990.pdb.gz	PYR1_DROME CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3
13	AFDB:P07259	0.928	0.632	0.000	2214	0.504	0.341	P07259.pdb.gz	PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA2 PE=1 SV=5
14	AFDB:P07756	0.983	0.983	0.000	1500	0.955	0.955	P07756.pdb.gz	CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus OX=10116 GN=Cps1 PE=1 SV=1
15	PDB:1jdbF	0.226	0.875	2.750E-36	380	0.094	0.371	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.
16	PDB:6g2iA	0.220	0.163	1.575E-17	2080	0.057	0.041	6g2iA.pdb.gz
17	PDB:1dv2A	0.210	0.632	5.492E-17	450	0.043	0.144	1dv2A.pdb.gz	Movement of the biotin carboxylase B-domain as a result of ATP binding.
18	PDB:5cskB	0.210	0.162	5.785E-17	2017	0.058	0.043	5cskB.pdb.gz
19	PDB:5cskA	0.217	0.167	9.241E-17	1996	0.056	0.042	5cskA.pdb.gz
20	PDB:5cslB	0.207	0.156	1.555E-16	2072	0.057	0.042	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y665	1482	2304	0.501	0.326	A0A8I5Y665_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=3 SV=1
2	A0A8I5ZMM2	1481	2321	0.500	0.323	A0A8I5ZMM2_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=1
3	A0A8I6A9Y4	1480	2154	0.500	0.348	A0A8I6A9Y4_RAT Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=1
4	B2RQC6	1477	2225	0.497	0.335	PYR1_MOUSE CAD protein OS=Mus musculus OX=10090 GN=Cad PE=1 SV=1
5	D4A8A0	1306	2162	0.465	0.322	D4A8A0_RAT CAD protein OS=Rattus norvegicus OX=10116 GN=Cad PE=1 SV=3
6	F8VPD4	1306	2162	0.461	0.320	F8VPD4_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=1
7	O93937	1551	2275	0.519	0.342	PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pyrABCN PE=3 SV=2
8	O94313	1139	1160	0.378	0.489	CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg4 PE=3 SV=1
9	P00968	815	1073	0.287	0.402	CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) OX=83333 GN=carB PE=1 SV=2
10	P03965	1104	1118	0.375	0.504	CARB_YEAST Carbamoyl-phosphate synthase arginine-specific large chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CPA2 PE=1 SV=1
11	P05990	1469	2224	0.501	0.338	PYR1_DROME CAD protein OS=Drosophila melanogaster OX=7227 GN=r PE=1 SV=3
12	P07259	1546	2214	0.503	0.341	PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA2 PE=1 SV=5
13	P07756	2996	1500	0.955	0.955	CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus OX=10116 GN=Cps1 PE=1 SV=1
14	P08955	1481	2225	0.498	0.336	PYR1_MESAU CAD protein OS=Mesocricetus auratus OX=10036 GN=CAD PE=1 SV=4
15	P20054	1557	2225	0.515	0.347	PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum OX=44689 GN=pyr1-3 PE=1 SV=3
16	P25994	865	1071	0.299	0.419	CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) OX=224308 GN=pyrAB PE=1 SV=1
17	P27708	1490	2225	0.499	0.337	PYR1_HUMAN CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3
18	P31327	3108	1500	1.000	1.000	CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens OX=9606 GN=CPS1 PE=1 SV=2
19	P38100	815	1073	0.289	0.404	CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=carB PE=3 SV=3
20	P9WPK3	733	1115	0.275	0.370	CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=carB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02222 ATP-grasp	3.8e-17	73.9	ATP-grasp domain
2	PF02655 ATP-grasp_3	0.048	25.2	ATP-grasp domain
3	PF15632 ATPgrasp_Ter	7.1e-08	43.7	ATP-grasp in the biosynthetic pathway with Ter operon
4	PF02786 CPSase_L_D2	4.2e-113	387.6	Carbamoyl-phosphate synthase L chain, ATP binding domain
5	PF02787 CPSase_L_D3	1.7e-23	93.7	Carbamoyl-phosphate synthetase large chain, oligomerisation domain
6	PF00988 CPSase_sm_chain	1.6e-40	149.3	Carbamoyl-phosphate synthase small chain, CPSase domain
7	PF07478 Dala_Dala_lig_C	1.4e-11	55.8	D-ala D-ala ligase C-terminus
8	PF00117 GATase	1.9e-37	140.4	Glutamine amidotransferase class-I
9	PF02142 MGS	2.6e-17	74.1	MGS-like domain
10	PF07722 Peptidase_C26	4.5e+02	12.0	Peptidase C26

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402608

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361471	0.995	Argininosuccinate synthase
2	9606.ENSP00000039007	0.991	Ornithine carbamoyltransferase, mitochondrial
3	9606.ENSP00000307900	0.962	Glutamine synthetase
4	9606.ENSP00000277865	0.953	Glutamate dehydrogenase 1, mitochondrial
5	9606.ENSP00000327589	0.943	Glutamate dehydrogenase 2, mitochondrial
6	9606.ENSP00000293404	0.935	N-acetylglutamate synthase, mitochondrial
7	9606.ENSP00000310447	0.929	Glutaminase liver isoform, mitochondrial
8	9606.ENSP00000317379	0.918	Glutaminase kidney isoform, mitochondrial
9	9606.ENSP00000264705	0.904	CAD protein
10	9606.ENSP00000232607	0.872	Uridine 5'-monophosphate synthase
11	9606.ENSP00000307188	0.847	Argininosuccinate lyase
12	9606.ENSP00000313490	0.798	Phosphoribosylformylglycinamidine synthase
13	9606.ENSP00000262426	0.779	Forkhead box protein F1
14	9606.ENSP00000378191	0.777	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
15	9606.ENSP00000371253	0.756	Trifunctional purine biosynthetic protein adenosine-3
16	9606.ENSP00000326272	0.749	Forkhead box protein L1
17	9606.ENSP00000302961	0.732	Heat shock protein family A member 4
18	9606.ENSP00000419851	0.721	GMP synthase [glutamine-hydrolyzing]
19	9606.ENSP00000360268	0.716	Delta-1-pyrroline-5-carboxylate synthase
20	9606.ENSP00000346453	0.712	Importin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016879	0.999	ligase activity, forming carbon-nitrogen bonds
GO:0005488	0.998	binding
GO:0005515	0.974	protein binding
GO:0004087	0.902	carbamoyl-phosphate synthase (ammonia) activity
GO:0016884	0.825	carbon-nitrogen ligase activity, with glutamine as amido-N-donor
GO:0016740	0.776	transferase activity
GO:0043167	0.708	ion binding
GO:0004088	0.700	carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity
GO:0036094	0.597	small molecule binding
GO:0016787	0.551	hydrolase activity
GO:0043169	0.384	cation binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901566	0.994	organonitrogen compound biosynthetic process
GO:0044271	0.994	cellular nitrogen compound biosynthetic process
GO:0044281	0.993	small molecule metabolic process
GO:0071941	0.985	nitrogen cycle metabolic process
GO:0043603	0.975	amide metabolic process
GO:0043604	0.960	amide biosynthetic process
GO:0044238	0.796	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.998	intracellular organelle lumen
GO:0005739	0.996	mitochondrion
GO:0031981	0.988	nuclear lumen
GO:0043232	0.592	intracellular non-membrane-bounded organelle
GO:0005759	0.522	mitochondrial matrix
GO:0005654	0.437	nucleoplasm
GO:0016020	0.392	membrane
GO:0005829	0.345	cytosol
GO:0005730	0.331	nucleolus
GO:0032991	0.301	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.-.-	0.999	Forming carbon-nitrogen bonds.
RHEA:18029	0.902	2 ATP + hydrogencarbonate + NH4(+) = 2 ADP + carbamoyl phosphate + 2 H(+) + phosphate
EC:6.3.4.16	0.902	carbamoyl-phosphate synthase (ammonia).
EC:6.3.5.-	0.825	Carbon--nitrogen ligases with glutamine as amido-N-donor.
EC:2.-.-.-	0.776	Transferases.
RHEA:18633	0.700	2 ATP + H2O + hydrogencarbonate + L-glutamine = 2 ADP + carbamoyl phosphate + 2 H(+) + L-glutamate + phosphate
EC:6.3.5.5	0.700	carbamoyl-phosphate synthase (glutamine-hydrolyzing).
EC:3.-.-.-	0.551	Hydrolases.

[back to server]