StarFunc result for job id P31350

User Input

>input (389 residues)
MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENTPPALSGTRVLASKTARRIFQEPTEPKT
KAAAPGVEDEPLLRENPRRFVIFPIEYHDIWQMYKKAEASFWTAEEVDLSKDIQHWESLK
PEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEERVREIIINAVRIE
QEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P11157	0.892	0.889	2.341E-45	390	0.915	0.913	P11157.pdb.gz	RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus OX=10090 GN=Rrm2 PE=1 SV=1
2	AFDB:P48592	0.810	0.802	1.032E-36	393	0.699	0.692	P48592.pdb.gz	RIR2_DROME Ribonucleoside-diphosphate reductase subunit M2 OS=Drosophila melanogaster OX=7227 GN=RnrS PE=1 SV=2
3	AFDB:D4ADQ1	0.792	0.876	1.171E-36	351	0.699	0.775	D4ADQ1.pdb.gz	D4ADQ1_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=3
4	AFDB:Q32PP6	0.782	0.870	2.731E-35	349	0.645	0.719	Q32PP6.pdb.gz
5	AFDB:P42170	0.827	0.844	1.673E-33	381	0.602	0.614	P42170.pdb.gz	RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain OS=Caenorhabditis elegans OX=6239 GN=rnr-2 PE=3 SV=1
6	AFDB:Q9LSD0	0.787	0.919	7.327E-32	332	0.573	0.672	Q9LSD0.pdb.gz	RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C OS=Arabidopsis thaliana OX=3702 GN=TSO2 PE=1 SV=1
7	AFDB:P50651	0.793	0.902	1.025E-31	341	0.553	0.630	P50651.pdb.gz	RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana OX=3702 GN=RNR2A PE=1 SV=2
8	PDB:1h0nA	0.731	0.985	1.307E-31	288	0.704	0.951	1h0nA.pdb.gz	Cobalt Substitution of Mouse R2 Ribonucleotide Reductase as a Model for Thereactive Diferrous State. Spectroscopic and Structural Evidence for a Ferromagnetically Coupled Dinuclear Cobalt Cluster
9	AFDB:P36603	0.776	0.772	2.582E-31	391	0.586	0.583	P36603.pdb.gz	RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suc22 PE=3 SV=2
10	AFDB:Q382Q0	0.764	0.879	7.695E-31	337	0.553	0.638	Q382Q0.pdb.gz	Q382Q0_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0007 PE=3 SV=1
11	AFDB:P42521	0.755	0.867	3.208E-30	338	0.540	0.621	P42521.pdb.gz	RIR2_DICDI Ribonucleoside-diphosphate reductase small subunit OS=Dictyostelium discoideum OX=44689 GN=rnrB-1 PE=2 SV=2
12	PDB:3hf1B	0.710	0.960	1.647E-28	286	0.617	0.839	3hf1B.pdb.gz	2.6 A X-ray crystal structure of human p53R2, a p53-inducible ribonucleotide reductase .
13	PDB:1jk0A	0.709	0.822	1.921E-24	334	0.519	0.605	1jk0A.pdb.gz	Structure of the yeast ribonucleotide reductase Y2Y4 heterodimer.
14	PDB:1smsA	0.696	0.856	1.706E-17	314	0.378	0.468	1smsA.pdb.gz
15	PDB:6w4xC	0.661	0.684	1.145E-8	375	0.201	0.208	6w4xC.pdb.gz	Structure of a trapped radical transfer pathway within a ribonucleotide reductase holocomplex.
16	PDB:1uzrB	0.569	0.752	1.976E-8	288	0.131	0.177	1uzrB.pdb.gz	Crystal Structure of the Biologically Active Form of Class Ib Ribonucleotide Reductase Small Subunit from Mycobacterium Tuberculosis
17	PDB:3n37A	0.606	0.813	4.977E-8	284	0.123	0.169	3n37A.pdb.gz	Structural basis for activation of class Ib ribonucleotide reductase.
18	PDB:4ac8A	0.508	0.624	4.327E-4	311	0.121	0.151	4ac8A.pdb.gz	A Dynamic C-Terminal Segment in the Mycobacterium Tuberculosis Mn/Fe R2Lox Protein Can Adopt a Helical Structure with Possible Functional Consequences.
19	PDB:1fziA	0.459	0.362	3.007E-2	512	0.118	0.090	1fziA.pdb.gz	Xenon and halogenated alkanes track putative substrate binding cavities in the soluble methane monooxygenase hydroxylase.
20	PDB:2xz1A	0.332	0.361	6.140E-2	353	0.082	0.091	2xz1A.pdb.gz	Remote Control of Regioselectivity in Acyl-Acyl Carrier Protein-Desaturases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6ACU7	0.0	511	299	0.620	0.806	A0A8I6ACU7_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=1
2	D4ADQ1	0.0	576	351	0.699	0.775	D4ADQ1_RAT Ribonucleotide reductase regulatory TP53 inducible subunit M2B OS=Rattus norvegicus OX=10116 GN=Rrm2b PE=3 SV=3
3	P11157	0.0	744	390	0.915	0.913	RIR2_MOUSE Ribonucleoside-diphosphate reductase subunit M2 OS=Mus musculus OX=10090 GN=Rrm2 PE=1 SV=1
4	P31350	0.0	805	389	1.000	1.000	RIR2_HUMAN Ribonucleoside-diphosphate reductase subunit M2 OS=Homo sapiens OX=9606 GN=RRM2 PE=1 SV=1
5	P48592	0.0	565	393	0.671	0.664	RIR2_DROME Ribonucleoside-diphosphate reductase subunit M2 OS=Drosophila melanogaster OX=7227 GN=RnrS PE=1 SV=2
6	Q4KLN6	0.0	734	390	0.900	0.897	RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus OX=10116 GN=Rrm2 PE=2 SV=1
7	Q6PEE3	0.0	572	351	0.689	0.764	RIR2B_MOUSE Ribonucleoside-diphosphate reductase subunit M2 B OS=Mus musculus OX=10090 GN=Rrm2b PE=1 SV=1
8	Q7LG56	0.0	578	351	0.697	0.772	RIR2B_HUMAN Ribonucleoside-diphosphate reductase subunit M2 B OS=Homo sapiens OX=9606 GN=RRM2B PE=1 SV=1
9	Q7ZYW0	0.0	542	349	0.640	0.713	Q7ZYW0_DANRE Ribonucleoside-diphosphate reductase subunit M2 B OS=Danio rerio OX=7955 GN=fb72h01 PE=3 SV=1
10	P42170	5.45e-170	481	381	0.578	0.591	RIR2_CAEEL Ribonucleoside-diphosphate reductase small chain OS=Caenorhabditis elegans OX=6239 GN=rnr-2 PE=3 SV=1
11	Q6FW29	4.38e-168	477	400	0.581	0.565	Q6FW29_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0D03432g PE=3 SV=1
12	P09938	2.23e-166	473	399	0.576	0.561	RIR2_YEAST Ribonucleoside-diphosphate reductase small chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNR2 PE=1 SV=2
13	P36603	2.55e-166	473	391	0.586	0.583	RIR2_SCHPO Ribonucleoside-diphosphate reductase small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=suc22 PE=3 SV=2
14	Q382Q2	1.48e-161	458	337	0.568	0.656	Q382Q2_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0005 PE=3 SV=1
15	Q382Q1	4.04e-161	457	337	0.568	0.656	Q382Q1_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0006 PE=3 SV=1
16	Q9LSD0	2.89e-160	455	332	0.586	0.687	RIR2C_ARATH Ribonucleoside-diphosphate reductase small chain C OS=Arabidopsis thaliana OX=3702 GN=TSO2 PE=1 SV=1
17	Q382Q3	4.68e-160	454	337	0.566	0.653	Q382Q3_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0004 PE=3 SV=1
18	Q382Q0	1.75e-157	448	337	0.555	0.641	Q382Q0_TRYB2 Ribonucleoside-diphosphate reductase small chain OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.v4.0007 PE=3 SV=1
19	P50651	5.56e-155	442	341	0.550	0.628	RIR2A_ARATH Ribonucleoside-diphosphate reductase small chain A OS=Arabidopsis thaliana OX=3702 GN=RNR2A PE=1 SV=2
20	P42521	3.48e-149	427	338	0.540	0.621	RIR2_DICDI Ribonucleoside-diphosphate reductase small subunit OS=Dictyostelium discoideum OX=44689 GN=rnrB-1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00268 Ribonuc_red_sm	7.7e-116	398.0	Ribonucleotide reductase, small chain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353770

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300738	0.999	Ribonucleoside-diphosphate reductase large subunit
2	9606.ENSP00000378699	0.992	Cyclin-dependent kinase 1
3	9606.ENSP00000287598	0.978	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
4	9606.ENSP00000411532	0.978	DNA topoisomerase 2-alpha
5	9606.ENSP00000251810	0.974	Ribonucleoside-diphosphate reductase subunit M2 B
6	9606.ENSP00000260731	0.974	Kinesin-like protein KIF11
7	9606.ENSP00000315644	0.973	Thymidylate synthase
8	9606.ENSP00000293677	0.969	Ribonucleoprotein PTB-binding 1
9	9606.ENSP00000361540	0.968	Cell division cycle protein 20 homolog
10	9606.ENSP00000416255	0.968	Eukaryotic translation initiation factor 4 gamma 1
11	9606.ENSP00000453403	0.968	Nucleolar and spindle-associated protein 1
12	9606.ENSP00000262105	0.967	DNA replication licensing factor MCM4
13	9606.ENSP00000357643	0.967	Proliferation marker protein Ki-67
14	9606.ENSP00000368458	0.966	Proliferating cell nuclear antigen
15	9606.ENSP00000274026	0.965	Cyclin-A2
16	9606.ENSP00000348838	0.964	Ubiquitin-conjugating enzyme E2 C
17	9606.ENSP00000360540	0.963	Centrosomal protein of 55 kDa
18	9606.ENSP00000265056	0.961	DNA replication licensing factor MCM2
19	9606.ENSP00000288207	0.961	G2/mitotic-specific cyclin-B2
20	9606.ENSP00000428489	0.959	Lymphokine-activated killer T-cell-originated protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004748	1.000	ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptor
GO:0042802	0.953	identical protein binding
GO:0046914	0.852	transition metal ion binding
GO:0005506	0.515	iron ion binding
GO:1901681	0.445	sulfur compound binding
GO:0046983	0.437	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.987	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006139	0.981	nucleobase-containing compound metabolic process
GO:0065007	0.972	biological regulation
GO:0055086	0.967	nucleobase-containing small molecule metabolic process
GO:0009117	0.956	nucleotide metabolic process
GO:0009262	0.954	deoxyribonucleotide metabolic process
GO:0050789	0.950	regulation of biological process
GO:0045787	0.943	positive regulation of cell cycle
GO:1901987	0.903	regulation of cell cycle phase transition
GO:0007346	0.861	regulation of mitotic cell cycle
GO:0090068	0.849	positive regulation of cell cycle process
GO:1901293	0.827	nucleoside phosphate biosynthetic process
GO:0045931	0.809	positive regulation of mitotic cell cycle
GO:1901989	0.724	positive regulation of cell cycle phase transition
GO:0009263	0.713	deoxyribonucleotide biosynthetic process
GO:0009132	0.700	nucleoside diphosphate metabolic process
GO:0019692	0.572	deoxyribose phosphate metabolic process
GO:0009394	0.548	2'-deoxyribonucleotide metabolic process
GO:0046385	0.524	deoxyribose phosphate biosynthetic process
GO:0009265	0.457	2'-deoxyribonucleotide biosynthetic process
GO:0043170	0.361	macromolecule metabolic process
GO:1901990	0.342	regulation of mitotic cell cycle phase transition
GO:0050896	0.340	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0031974	0.987	membrane-enclosed lumen
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005971	0.985	ribonucleoside-diphosphate reductase complex
GO:0005654	0.978	nucleoplasm
GO:0043232	0.904	intracellular non-membrane-bounded organelle
GO:0012505	0.549	endomembrane system
GO:0016020	0.471	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23252	1.000	[thioredoxin]-disulfide + a 2'-deoxyribonucleoside 5'-diphosphate + H2O = [thioredoxin]-dithiol + a ribonucleoside 5'-diphosphate
EC:1.17.4.1	1.000	ribonucleoside-diphosphate reductase.

[back to server]