StarFunc result for job id P31371

User Input

>input (208 residues)
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31371	1.000	1.000	4.454E-39	208	1.000	1.000	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
2	AFDB:Q9EST9	0.815	0.800	2.156E-31	212	0.716	0.703	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
3	AFDB:Q2LJ24	0.761	0.761	2.978E-30	208	0.707	0.707	Q2LJ24.pdb.gz	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
4	AFDB:Q38PL0	0.738	0.738	9.687E-29	208	0.654	0.654	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
5	AFDB:O43320	0.752	0.756	1.026E-28	207	0.668	0.671	O43320.pdb.gz	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
6	PDB:3f1rA	0.730	0.965	5.574E-26	157	0.620	0.822	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
7	AFDB:Q2HXK8	0.704	0.720	1.363E-25	203	0.611	0.626	Q2HXK8.pdb.gz	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
8	AFDB:P70492	0.623	0.603	6.598E-18	215	0.332	0.321	P70492.pdb.gz	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
9	AFDB:P48802	0.661	0.541	7.396E-18	256	0.346	0.281	P48802.pdb.gz	FGF3_DANRE Fibroblast growth factor 3 OS=Danio rerio OX=7955 GN=fgf3 PE=1 SV=1
10	AFDB:O42407	0.621	0.610	1.042E-17	212	0.312	0.307	O42407.pdb.gz	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
11	AFDB:Q1XG76	0.608	0.611	1.843E-17	207	0.327	0.329	Q1XG76.pdb.gz	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
12	PDB:4jq0A	0.606	0.882	1.041E-13	141	0.236	0.348	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
13	PDB:1ry7A	0.589	0.801	6.844E-13	151	0.269	0.371	1ry7A.pdb.gz
14	PDB:4qd2B	0.519	0.728	1.120E-5	143	0.067	0.098	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
15	PDB:6b0tA	0.493	0.221	2.058E-4	487	0.077	0.033	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
16	PDB:1hcdA	0.440	0.713	2.738E-4	118	0.082	0.144	1hcdA.pdb.gz
17	PDB:3malA	0.367	0.417	5.130E-4	181	0.091	0.105	3malA.pdb.gz
18	PDB:7t3qA	0.457	0.057	6.089E-4	2103	0.125	0.012	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:3wmuB	0.455	0.597	9.613E-4	153	0.111	0.150	3wmuB.pdb.gz
20	PDB:7vmlA	0.461	0.031	1.279E-3	4044	0.111	0.006	7vmlA.pdb.gz	Molecular basis for gating of cardiac ryanodine receptor explains the mechanisms for gain- and loss-of function mutations.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31371	6.08e-155	429	208	1.000	1.000	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
2	P36364	2.24e-154	427	208	0.995	0.995	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
3	P54130	2.24e-154	427	208	0.995	0.995	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
4	Q9ESL9	2.06e-104	301	211	0.721	0.711	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2
5	Q2LJ24	3.96e-104	300	208	0.726	0.726	Q2LJ24_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=fgf20b PE=2 SV=1
6	O43320	1.41e-103	299	207	0.716	0.720	FGF16_HUMAN Fibroblast growth factor 16 OS=Homo sapiens OX=9606 GN=FGF16 PE=1 SV=1
7	Q9EST9	2.62e-103	298	212	0.716	0.703	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
8	O54769	3.46e-103	298	207	0.712	0.715	FGF16_RAT Fibroblast growth factor 16 OS=Rattus norvegicus OX=10116 GN=Fgf16 PE=2 SV=1
9	Q38PL0	1.62e-100	291	208	0.692	0.692	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
10	Q9NP95	4.70e-100	290	211	0.707	0.697	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
11	Q2HXK8	6.27e-98	284	203	0.692	0.709	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
12	O15520	7.87e-38	132	208	0.298	0.298	FGF10_HUMAN Fibroblast growth factor 10 OS=Homo sapiens OX=9606 GN=FGF10 PE=1 SV=1
13	P70492	9.53e-38	132	215	0.298	0.288	FGF10_RAT Fibroblast growth factor 10 OS=Rattus norvegicus OX=10116 GN=Fgf10 PE=2 SV=1
14	P11487	1.66e-36	129	239	0.317	0.276	FGF3_HUMAN Fibroblast growth factor 3 OS=Homo sapiens OX=9606 GN=FGF3 PE=1 SV=1
15	O42407	2.56e-36	128	212	0.288	0.283	O42407_CHICK Fibroblast growth factor OS=Gallus gallus OX=9031 PE=2 SV=2
16	O35565	4.92e-36	127	209	0.284	0.282	FGF10_MOUSE Fibroblast growth factor 10 OS=Mus musculus OX=10090 GN=Fgf10 PE=2 SV=1
17	Q9ESS2	9.24e-36	125	162	0.308	0.395	FGF22_MOUSE Fibroblast growth factor 22 OS=Mus musculus OX=10090 GN=Fgf22 PE=2 SV=1
18	Q92915	1.46e-35	127	247	0.279	0.235	FGF14_HUMAN Fibroblast growth factor 14 OS=Homo sapiens OX=9606 GN=FGF14 PE=1 SV=1
19	Q8R5L7	3.34e-35	126	247	0.279	0.235	FGF14_RAT Fibroblast growth factor 14 OS=Rattus norvegicus OX=10116 GN=Fgf14 PE=2 SV=1
20	P70379	3.45e-35	126	247	0.279	0.235	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00167 FGF	7.3e-44	160.2	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006159582.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006170698.1	0.983	Fibroblast growth factor receptor 1 isoform X1
2	246437.XP_006152957.1	0.976	Fibroblast growth factor receptor 3
3	246437.XP_006144007.1	0.959	Fibroblast growth factor receptor
4	246437.XP_006158993.1	0.935	Receptor protein-tyrosine kinase
5	246437.XP_006143748.1	0.838	Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
6	246437.XP_006165895.1	0.821	Vascular endothelial growth factor receptor 1
7	246437.XP_006148980.1	0.815	Receptor protein-tyrosine kinase
8	246437.XP_006143746.1	0.814	Mast/stem cell growth factor receptor Kit isoform X1
9	246437.XP_006150946.1	0.795	Tyrosine-protein kinase that acts as cell-surface receptor for homodimeric PDGFB and PDGFD and for heterodimers formed by PDGFA and PDGFB, and plays an essential role in the regulation of embryonic development, cell proliferation, survival, differentiation, chemotaxis and migration. Plays an essential role in blood vessel development by promoting proliferation, migration and recruitment of pericytes and smooth muscle cells to endothelial cells.
10	246437.XP_006158520.1	0.788	Klotho
11	246437.XP_006143288.1	0.784	TEK receptor tyrosine kinase
12	246437.XP_006147556.1	0.783	Vascular endothelial growth factor receptor 3
13	246437.XP_006162324.1	0.777	Pro-epidermal growth factor
14	246437.XP_006145948.1	0.767	Transcription factor SOX-9
15	246437.XP_006162438.1	0.767	Hepatocyte growth factor receptor
16	246437.XP_006143745.1	0.757	Tyrosine-protein kinase that acts as a cell-surface receptor for PDGFA, PDGFB and PDGFC and plays an essential role in the regulation of embryonic development, cell proliferation, survival and chemotaxis. Depending on the context, promotes or inhibits cell proliferation and cell migration. Plays an important role in the differentiation of bone marrow-derived mesenchymal stem cells. Required for normal skeleton development
17	246437.XP_006140156.1	0.748	Erb-b2 receptor tyrosine kinase 4
18	246437.XP_006155829.1	0.747	Hepatocyte growth factor
19	246437.XP_006155965.1	0.744	Receptor protein-tyrosine kinase
20	246437.XP_006165652.1	0.744	Erb-b2 receptor tyrosine kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	1.000	growth factor activity
GO:0070851	0.703	growth factor receptor binding
GO:0005104	0.613	fibroblast growth factor receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0048522	0.995	positive regulation of cellular process
GO:0048856	0.993	anatomical structure development
GO:0042127	0.993	regulation of cell population proliferation
GO:0009987	0.992	cellular process
GO:0032501	0.988	multicellular organismal process
GO:0023052	0.986	signaling
GO:0009719	0.985	response to endogenous stimulus
GO:0070848	0.984	response to growth factor
GO:0007165	0.984	signal transduction
GO:0008284	0.983	positive regulation of cell population proliferation
GO:0007167	0.972	enzyme-linked receptor protein signaling pathway
GO:0071363	0.968	cellular response to growth factor stimulus
GO:0007275	0.965	multicellular organism development
GO:0071774	0.960	response to fibroblast growth factor
GO:0007169	0.955	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048513	0.939	animal organ development
GO:0030335	0.934	positive regulation of cell migration
GO:0048731	0.916	system development
GO:0019222	0.872	regulation of metabolic process
GO:0060255	0.863	regulation of macromolecule metabolic process
GO:0044344	0.819	cellular response to fibroblast growth factor stimulus
GO:0009887	0.818	animal organ morphogenesis
GO:0009888	0.812	tissue development
GO:0009893	0.804	positive regulation of metabolic process
GO:0008543	0.798	fibroblast growth factor receptor signaling pathway
GO:0051239	0.787	regulation of multicellular organismal process
GO:0010604	0.770	positive regulation of macromolecule metabolic process
GO:0031323	0.765	regulation of cellular metabolic process
GO:0050793	0.721	regulation of developmental process
GO:0048583	0.718	regulation of response to stimulus
GO:0048519	0.717	negative regulation of biological process
GO:0080090	0.708	regulation of primary metabolic process
GO:0051171	0.639	regulation of nitrogen compound metabolic process
GO:0048523	0.621	negative regulation of cellular process
GO:0023051	0.599	regulation of signaling
GO:0010646	0.596	regulation of cell communication
GO:0010468	0.592	regulation of gene expression
GO:0007399	0.591	nervous system development
GO:0031325	0.570	positive regulation of cellular metabolic process
GO:0009966	0.559	regulation of signal transduction
GO:0051173	0.525	positive regulation of nitrogen compound metabolic process
GO:0030154	0.510	cell differentiation
GO:0048584	0.479	positive regulation of response to stimulus
GO:0009967	0.456	positive regulation of signal transduction
GO:0019219	0.409	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.389	regulation of cellular biosynthetic process
GO:0010556	0.375	regulation of macromolecule biosynthetic process
GO:0051252	0.368	regulation of RNA metabolic process
GO:0007267	0.365	cell-cell signaling
GO:2000026	0.364	regulation of multicellular organismal development
GO:0006355	0.358	regulation of DNA-templated transcription
GO:0022414	0.356	reproductive process
GO:0045935	0.356	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.351	positive regulation of biosynthetic process
GO:0031328	0.344	positive regulation of cellular biosynthetic process
GO:1902531	0.342	regulation of intracellular signal transduction
GO:0010557	0.341	positive regulation of macromolecule biosynthetic process
GO:0007420	0.322	brain development
GO:0045595	0.312	regulation of cell differentiation
GO:0051094	0.309	positive regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.954	cell periphery
GO:0005622	0.898	intracellular anatomical structure
GO:0005615	0.871	extracellular space
GO:0005737	0.804	cytoplasm
GO:0043226	0.558	organelle
GO:0005886	0.487	plasma membrane
GO:0043227	0.486	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]