StarFunc result for job id P31391

User Input

>input (388 residues)
MSAPSTLPPGGEEGLGTAWPSAANASSAPAEAEEAVAGPGDARAAGMVAIQCIYALVCLV
GLVGNALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCR
AVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLP
IAIFADTRPARGGQAVACNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRA
VALRAGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILS
YANSCANPILYGFLSDNFRRFFQRVLCLRCCLLEGAGGAEEEPLDYYATALKSKGGAGCM
CPPLPCQQEALQPEPGRKRIPLTRTTTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31391	1.000	1.000	2.786E-51	388	1.000	1.000	P31391.pdb.gz	SSR4_HUMAN Somatostatin receptor type 4 OS=Homo sapiens OX=9606 GN=SSTR4 PE=1 SV=2
2	AFDB:P49660	0.854	0.860	3.676E-41	385	0.863	0.870	P49660.pdb.gz	SSR4_MOUSE Somatostatin receptor type 4 OS=Mus musculus OX=10090 GN=Sstr4 PE=1 SV=2
3	AFDB:Q5G546	0.747	0.779	2.412E-32	371	0.585	0.612	Q5G546.pdb.gz	Q5G546_ONCMY Somatostatin receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=SSTR1B PE=2 SV=1
4	AFDB:P28646	0.804	0.798	2.878E-32	391	0.582	0.578	P28646.pdb.gz	SSR1_RAT Somatostatin receptor type 1 OS=Rattus norvegicus OX=10116 GN=Sstr1 PE=2 SV=1
5	AFDB:P30680	0.761	0.799	1.561E-27	369	0.428	0.450	P30680.pdb.gz	SSR2_RAT Somatostatin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Sstr2 PE=1 SV=1
6	AFDB:P35346	0.717	0.762	4.705E-27	364	0.477	0.508	P35346.pdb.gz	SSR5_HUMAN Somatostatin receptor type 5 OS=Homo sapiens OX=9606 GN=SSTR5 PE=1 SV=3
7	AFDB:P30938	0.732	0.780	2.750E-26	363	0.472	0.504	P30938.pdb.gz	SSR5_RAT Somatostatin receptor type 5 OS=Rattus norvegicus OX=10116 GN=Sstr5 PE=1 SV=2
8	AFDB:Q6YEY1	0.726	0.758	6.947E-26	371	0.477	0.499	Q6YEY1.pdb.gz	Q6YEY1_PIG Somatostatin receptor subtype 5 OS=Sus scrofa OX=9823 PE=2 SV=2
9	AFDB:P32745	0.700	0.651	1.171E-24	418	0.448	0.416	P32745.pdb.gz	SSR3_HUMAN Somatostatin receptor type 3 OS=Homo sapiens OX=9606 GN=SSTR3 PE=1 SV=1
10	AFDB:D7REY1	0.723	0.753	2.479E-24	372	0.438	0.457	D7REY1.pdb.gz	D7REY1_ONCMY Somatostatin receptor type 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	PDB:7wicR	0.667	0.886	1.343E-21	288	0.389	0.524	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
12	PDB:8ef5M	0.662	0.879	1.649E-19	288	0.304	0.410	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
13	PDB:4djhB	0.653	0.568	1.854E-17	448	0.317	0.275	4djhB.pdb.gz	tructure of the human kappa-opioid receptor in complex with JDTic
14	PDB:4dklA	0.668	0.588	2.883E-17	442	0.307	0.269	4dklA.pdb.gz	Crystal structure of the {mu}-opioid receptor bound to a morphinan antagonist.
15	PDB:4ej4A	0.634	0.558	4.859E-16	442	0.325	0.285	4ej4A.pdb.gz	Structure of the delta opioid receptor bound to naltrindole
16	PDB:7wq3R	0.648	0.857	7.228E-16	289	0.250	0.336	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
17	PDB:7vl9R	0.648	0.820	5.267E-15	302	0.211	0.272	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
18	PDB:7f1qR	0.628	0.663	5.505E-15	367	0.211	0.223	7f1qR.pdb.gz
19	PDB:7mbyR	0.640	0.863	1.659E-14	283	0.216	0.297	7mbyR.pdb.gz	Structures of the human cholecystokinin 1 (CCK1) receptor bound to Gs and Gq mimetic proteins provide insight into mechanisms of G protein selectivity.
20	PDB:7wq4R	0.634	0.856	2.162E-14	282	0.268	0.369	7wq4R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P30937	0.0	687	384	0.881	0.891	SSR4_RAT Somatostatin receptor type 4 OS=Rattus norvegicus OX=10116 GN=Sstr4 PE=1 SV=1
2	P31391	0.0	783	388	1.000	1.000	SSR4_HUMAN Somatostatin receptor type 4 OS=Homo sapiens OX=9606 GN=SSTR4 PE=1 SV=2
3	P49660	0.0	677	385	0.866	0.873	SSR4_MOUSE Somatostatin receptor type 4 OS=Mus musculus OX=10090 GN=Sstr4 PE=1 SV=2
4	Q6YEY0	1.44e-178	498	253	0.644	0.988	Q6YEY0_PIG Somatostatin receptor subtype 4 (Fragment) OS=Sus scrofa OX=9823 PE=2 SV=1
5	Q5G546	6.54e-151	432	371	0.580	0.606	Q5G546_ONCMY Somatostatin receptor 1b OS=Oncorhynchus mykiss OX=8022 GN=SSTR1B PE=2 SV=1
6	Q866U3	8.27e-148	426	390	0.567	0.564	Q866U3_PIG Somatostatin receptor subtype 1 OS=Sus scrofa OX=9823 PE=2 SV=2
7	Q5G547	9.33e-147	422	371	0.580	0.606	Q5G547_ONCMY Somatostatin receptor type 1 subtype A OS=Oncorhynchus mykiss OX=8022 GN=SSTR1A PE=2 SV=1
8	P30873	4.55e-146	421	391	0.575	0.570	SSR1_MOUSE Somatostatin receptor type 1 OS=Mus musculus OX=10090 GN=Sstr1 PE=1 SV=1
9	P28646	5.78e-146	421	391	0.564	0.560	SSR1_RAT Somatostatin receptor type 1 OS=Rattus norvegicus OX=10116 GN=Sstr1 PE=2 SV=1
10	P30872	6.59e-146	421	391	0.575	0.570	SSR1_HUMAN Somatostatin receptor type 1 OS=Homo sapiens OX=9606 GN=SSTR1 PE=1 SV=1
11	Q9GKP7	5.12e-131	380	315	0.513	0.632	Q9GKP7_PIG Somatostatin receptor 1 (Fragment) OS=Sus scrofa OX=9823 GN=SSTR1 PE=3 SV=1
12	P35346	1.59e-108	325	364	0.448	0.478	SSR5_HUMAN Somatostatin receptor type 5 OS=Homo sapiens OX=9606 GN=SSTR5 PE=1 SV=3
13	D7REY1	8.17e-107	320	372	0.456	0.476	D7REY1_ONCMY Somatostatin receptor type 2 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	P30875	2.67e-106	319	369	0.430	0.453	SSR2_MOUSE Somatostatin receptor type 2 OS=Mus musculus OX=10090 GN=Sstr2 PE=2 SV=1
15	P30680	6.03e-106	318	369	0.430	0.453	SSR2_RAT Somatostatin receptor type 2 OS=Rattus norvegicus OX=10116 GN=Sstr2 PE=1 SV=1
16	P34994	1.33e-105	317	369	0.428	0.450	SSR2_PIG Somatostatin receptor type 2 OS=Sus scrofa OX=9823 GN=SSTR2 PE=3 SV=1
17	P30874	2.76e-104	314	369	0.410	0.431	SSR2_HUMAN Somatostatin receptor type 2 OS=Homo sapiens OX=9606 GN=SSTR2 PE=1 SV=1
18	Q6YEY1	6.61e-102	308	371	0.466	0.488	Q6YEY1_PIG Somatostatin receptor subtype 5 OS=Sus scrofa OX=9823 PE=2 SV=2
19	P30938	1.72e-97	296	363	0.451	0.482	SSR5_RAT Somatostatin receptor type 5 OS=Rattus norvegicus OX=10116 GN=Sstr5 PE=1 SV=2
20	O08858	4.34e-97	295	362	0.428	0.459	SSR5_MOUSE Somatostatin receptor type 5 OS=Mus musculus OX=10090 GN=Sstr5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2e-58	209.3	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.064	24.6	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1.6e-09	49.1	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10323 7TM_GPCR_Srv	0.0045	28.0	Serpentine type 7TM GPCR chemoreceptor Srv
5	PF10324 7TM_GPCR_Srw	0.016	26.1	Serpentine type 7TM GPCR chemoreceptor Srw
6	PF10328 7TM_GPCR_Srx	0.0048	28.1	Serpentine type 7TM GPCR chemoreceptor Srx
7	PF11119 DUF2633	3.4e+02	12.5	Protein of unknown function (DUF2633)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287641	0.959	Somatostatin
2	9606.ENSP00000366248	0.824	Cortistatin
3	9606.ENSP00000216962	0.764	Glycogen phosphorylase, brain form
4	9606.ENSP00000337168	0.635	Band 4.1-like protein 1
5	9606.ENSP00000217420	0.633	Vesicular inhibitory amino acid transporter
6	9606.ENSP00000382428	0.609	Disks large homolog 4
7	9606.ENSP00000262545	0.605	Neuroendocrine convertase 2
8	9606.ENSP00000356575	0.527	Transcription factor HIVEP2
9	9606.ENSP00000292513	0.518	Prostaglandin E2 receptor EP1 subtype

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005515	0.998	protein binding
GO:0008188	0.977	neuropeptide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0050896	0.989	response to stimulus
GO:0007186	0.977	G protein-coupled receptor signaling pathway
GO:0048523	0.623	negative regulation of cellular process
GO:0007187	0.450	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0032501	0.388	multicellular organismal process
GO:0048518	0.370	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.938	intracellular anatomical structure
GO:0005737	0.670	cytoplasm
GO:0043226	0.552	organelle
GO:0043227	0.492	membrane-bounded organelle
GO:0043229	0.472	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]