StarFunc result for job id P31415

User Input

>input (396 residues)
MSATDRMGPRAVPGLRLALLLLLVLGTPKSGVQGQEGLDFPEYDGVDRVINVNAKNYKNV
FKKYEVLALLYHEPPEDDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKK
LGLTEVDSMYVFKGDEVIEYDGEFSADTIVEFLLDVLEDPVELIEGERELQAFENIEDEI
KLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPV
TIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIVAFAEEADPDGFEFL
ETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADSVWME
MDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19633	0.917	0.894	8.830E-79	406	0.957	0.933	P19633.pdb.gz	CASQ1_RAT Calsequestrin-1 OS=Rattus norvegicus OX=10116 GN=Casq1 PE=1 SV=2
2	PDB:5crgA	0.877	0.980	2.355E-69	354	0.891	0.997	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
3	AFDB:F1NQT9	0.902	0.880	9.326E-64	406	0.659	0.643	F1NQT9.pdb.gz	F1NQT9_CHICK Calsequestrin OS=Gallus gallus OX=9031 GN=CASQ2 PE=3 SV=1
4	AFDB:P12637	0.919	0.888	3.958E-62	410	0.631	0.610	P12637.pdb.gz	CASQ2_CANLF Calsequestrin-2 OS=Canis lupus familiaris OX=9615 GN=CASQ2 PE=1 SV=1
5	AFDB:O09161	0.901	0.861	6.085E-62	415	0.609	0.581	O09161.pdb.gz	CASQ2_MOUSE Calsequestrin-2 OS=Mus musculus OX=10090 GN=Casq2 PE=1 SV=3
6	AFDB:C0KTH7	0.900	0.842	1.028E-60	424	0.616	0.575	C0KTH7.pdb.gz	C0KTH7_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	AFDB:Q7T138	0.913	0.626	4.490E-60	579	0.611	0.418	Q7T138.pdb.gz
8	PDB:7f05C	0.865	0.963	5.657E-59	355	0.614	0.685	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
9	AFDB:F6P0J3	0.869	0.759	2.930E-58	454	0.606	0.529	F6P0J3.pdb.gz	F6P0J3_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
10	AFDB:Q20203	0.795	0.757	4.139E-34	417	0.333	0.317	Q20203.pdb.gz	Q20203_CAEEL Calsequestrin OS=Caenorhabditis elegans OX=6239 GN=csq-1 PE=1 SV=1
11	AFDB:Q4WH99	0.541	0.439	5.058E-24	517	0.202	0.155	Q4WH99.pdb.gz	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
12	AFDB:Q2HWU2	0.497	0.405	6.679E-23	510	0.177	0.137	Q2HWU2.pdb.gz	PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata OX=9543 GN=P4HB PE=2 SV=1
13	PDB:4ekzA	0.490	0.430	1.463E-21	469	0.179	0.151	4ekzA.pdb.gz
14	PDB:5gu6A	0.533	0.553	8.200E-19	377	0.154	0.162	5gu6A.pdb.gz
15	PDB:3f8uA	0.575	0.500	8.720E-19	469	0.152	0.128	3f8uA.pdb.gz
16	PDB:2r2jA	0.457	0.523	6.434E-17	328	0.146	0.177	2r2jA.pdb.gz
17	PDB:3apoA	0.303	0.201	2.494E-14	688	0.116	0.067	3apoA.pdb.gz
18	PDB:4f9zA	0.296	0.472	2.510E-10	219	0.086	0.155	4f9zA.pdb.gz
19	PDB:3ed3A	0.252	0.359	1.002E-8	267	0.083	0.124	3ed3A.pdb.gz
20	PDB:7scdA	0.211	0.224	7.635E-6	371	0.076	0.081	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NQT9	0.0	517	406	0.639	0.623	F1NQT9_CHICK Calsequestrin OS=Gallus gallus OX=9031 GN=CASQ2 PE=3 SV=1
2	O09161	0.0	511	415	0.609	0.581	CASQ2_MOUSE Calsequestrin-2 OS=Mus musculus OX=10090 GN=Casq2 PE=1 SV=3
3	O09165	0.0	737	405	0.927	0.906	CASQ1_MOUSE Calsequestrin-1 OS=Mus musculus OX=10090 GN=Casq1 PE=1 SV=3
4	P07221	0.0	704	395	0.914	0.916	CASQ1_RABIT Calsequestrin-1 OS=Oryctolagus cuniculus OX=9986 GN=CASQ1 PE=1 SV=1
5	P19204	0.0	516	406	0.639	0.623	CASQ2_CHICK Calsequestrin-2 OS=Gallus gallus OX=9031 GN=CASQ2 PE=1 SV=1
6	P19633	0.0	744	406	0.937	0.914	CASQ1_RAT Calsequestrin-1 OS=Rattus norvegicus OX=10116 GN=Casq1 PE=1 SV=2
7	P31415	0.0	786	396	1.000	1.000	CASQ1_HUMAN Calsequestrin-1 OS=Homo sapiens OX=9606 GN=CASQ1 PE=1 SV=3
8	P51868	2.41e-179	507	413	0.598	0.574	CASQ2_RAT Calsequestrin-2 OS=Rattus norvegicus OX=10116 GN=Casq2 PE=1 SV=2
9	O14958	1.13e-178	504	399	0.614	0.609	CASQ2_HUMAN Calsequestrin-2 OS=Homo sapiens OX=9606 GN=CASQ2 PE=1 SV=2
10	P12637	1.79e-177	502	410	0.614	0.593	CASQ2_CANLF Calsequestrin-2 OS=Canis lupus familiaris OX=9615 GN=CASQ2 PE=1 SV=1
11	A0A060WP64	1.65e-176	499	419	0.604	0.570	A0A060WP64_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00042044001 PE=3 SV=1
12	P31235	3.15e-175	496	409	0.606	0.587	CASQ2_RABIT Calsequestrin-2 OS=Oryctolagus cuniculus OX=9986 GN=CASQ2 PE=1 SV=1
13	C0KTH8	7.66e-175	495	410	0.598	0.578	C0KTH8_ONCMY Calsequestrin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	C0KTH7	8.83e-175	496	424	0.596	0.557	C0KTH7_ONCMY Calsequestrin OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	Q08BX6	4.02e-174	494	443	0.606	0.542	Q08BX6_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
16	C0KTH9	4.20e-174	494	418	0.598	0.567	C0KTH9_ONCMY Calsequestrin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
17	F6P0J3	1.73e-167	478	454	0.601	0.524	F6P0J3_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=zgc:154027 PE=1 SV=1
18	A0A0R4IKE0	2.46e-166	479	553	0.604	0.432	A0A0R4IKE0_DANRE Calsequestrin OS=Danio rerio OX=7955 GN=bZ1G18.2 PE=1 SV=2
19	O18934	6.21e-75	231	160	0.275	0.681	CASQ2_PIG Calsequestrin-2 (Fragment) OS=Sus scrofa OX=9823 GN=CASQ2 PE=2 SV=1
20	Q20203	8.29e-53	183	417	0.323	0.307	Q20203_CAEEL Calsequestrin OS=Caenorhabditis elegans OX=6239 GN=csq-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01216 Calsequestrin	6.4e-239	804.1	Calsequestrin
2	PF04756 OST3_OST6	9.9	17.0	OST3 / OST6 family, transporter family
3	PF00085 Thioredoxin	4.9e+02	12.1	Thioredoxin
4	PF13848 Thioredoxin_6	6.9e-20	83.2	Thioredoxin-like domain
5	PF10273 WGG	3.6e+02	13.0	Pre-rRNA-processing protein TSR2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357057

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000439281	0.977	Triadin
2	9606.ENSP00000368767	0.967	Aspartyl/asparaginyl beta-hydroxylase
3	9606.ENSP00000355533	0.935	Ryanodine receptor 2
4	9606.ENSP00000352608	0.916	Ryanodine receptor 1
5	9606.ENSP00000352272	0.879	Myozenin-1
6	9606.ENSP00000261448	0.816	Calsequestrin-2
7	9606.ENSP00000349595	0.813	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
8	9606.ENSP00000373884	0.795	Ryanodine receptor 3
9	9606.ENSP00000307280	0.738	Myosin light chain 1/3, skeletal muscle isoform
10	9606.ENSP00000478059	0.693	Stromal interaction molecule 1
11	9606.ENSP00000382518	0.686	Sarcalumenin
12	9606.ENSP00000440045	0.640	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
13	9606.ENSP00000420588	0.630	Transcription factor A, mitochondrial
14	9606.ENSP00000262113	0.624	Myomesin-2
15	9606.ENSP00000341838	0.621	Troponin I, cardiac muscle
16	9606.ENSP00000371331	0.621	Troponin I, fast skeletal muscle
17	9606.ENSP00000300961	0.617	Junctional sarcoplasmic reticulum protein 1
18	9606.ENSP00000422007	0.603	Alpha-actinin-3
19	9606.ENSP00000327758	0.601	Homeobox protein Nkx-2.5
20	9606.ENSP00000355192	0.599	Voltage-dependent L-type calcium channel subunit alpha-1S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005509	1.000	calcium ion binding
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0090257	0.980	regulation of muscle system process
GO:0032412	0.950	regulation of monoatomic ion transmembrane transporter activity
GO:0051924	0.949	regulation of calcium ion transport
GO:0051279	0.929	regulation of release of sequestered calcium ion into cytosol
GO:0050896	0.897	response to stimulus
GO:0051258	0.897	protein polymerization
GO:0048856	0.858	anatomical structure development
GO:0051179	0.813	localization
GO:0051235	0.778	maintenance of location
GO:1901019	0.778	regulation of calcium ion transmembrane transporter activity
GO:0061061	0.771	muscle structure development
GO:0048518	0.765	positive regulation of biological process
GO:0048522	0.706	positive regulation of cellular process
GO:0032501	0.666	multicellular organismal process
GO:2001257	0.599	regulation of cation channel activity
GO:0051716	0.478	cellular response to stimulus
GO:0007154	0.475	cell communication
GO:0023052	0.473	signaling
GO:0043270	0.455	positive regulation of monoatomic ion transport
GO:0034767	0.450	positive regulation of monoatomic ion transmembrane transport
GO:0044093	0.447	positive regulation of molecular function
GO:0006937	0.439	regulation of muscle contraction
GO:1904064	0.431	positive regulation of cation transmembrane transport
GO:0010880	0.397	regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum
GO:0006942	0.354	regulation of striated muscle contraction
GO:0003012	0.352	muscle system process
GO:0032414	0.334	positive regulation of ion transmembrane transporter activity
GO:0007165	0.330	signal transduction
GO:0048519	0.311	negative regulation of biological process
GO:0051238	0.302	sequestering of metal ion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016529	0.988	sarcoplasmic reticulum
GO:0043233	0.985	organelle lumen
GO:0070013	0.984	intracellular organelle lumen
GO:0031984	0.712	organelle subcompartment
GO:0098827	0.660	endoplasmic reticulum subcompartment
GO:0016020	0.413	membrane
GO:0043232	0.389	intracellular non-membrane-bounded organelle
GO:0005788	0.366	endoplasmic reticulum lumen
GO:0031981	0.313	nuclear lumen
GO:0098588	0.303	bounding membrane of organelle
GO:0005789	0.303	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]