StarFunc result for job id P31431

User Input

>input (198 residues)
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31431	1.000	1.000	1.252E-27	198	1.000	1.000	P31431.pdb.gz	SDC4_HUMAN Syndecan-4 OS=Homo sapiens OX=9606 GN=SDC4 PE=1 SV=2
2	AFDB:P34901	0.308	0.301	7.565E-21	202	0.793	0.777	P34901.pdb.gz	SDC4_RAT Syndecan-4 OS=Rattus norvegicus OX=10116 GN=Sdc4 PE=1 SV=1
3	AFDB:Q5I5K4	0.256	0.257	7.065E-10	197	0.545	0.548	Q5I5K4.pdb.gz	Q5I5K4_MELGA Syndecan OS=Meleagris gallopavo OX=9103 PE=2 SV=1
4	AFDB:Q1AGV6	0.312	0.302	3.599E-6	205	0.359	0.346	Q1AGV6.pdb.gz	SDC4B_XENLA Syndecan 4-B OS=Xenopus laevis OX=8355 GN=sdc4-b PE=1 SV=1
5	AFDB:P43407	0.236	0.232	1.079E-4	202	0.369	0.361	P43407.pdb.gz	SDC2_MOUSE Syndecan-2 OS=Mus musculus OX=10090 GN=Sdc2 PE=1 SV=1
6	AFDB:A0A1D5PEN8	0.209	0.106	1.065E-3	405	0.323	0.158	A0A1D5PEN8.pdb.gz
7	AFDB:P26260	0.195	0.126	2.257E-2	313	0.268	0.169	P26260.pdb.gz	SDC1_RAT Syndecan-1 OS=Rattus norvegicus OX=10116 GN=Sdc1 PE=1 SV=2
8	AFDB:Q9R0H2	0.155	0.123	5.494E-1	261	0.197	0.149	Q9R0H2.pdb.gz	MUCEN_MOUSE Endomucin OS=Mus musculus OX=10090 GN=Emcn PE=1 SV=1
9	AFDB:P14220	0.204	0.238	5.889E-1	168	0.146	0.173	P14220.pdb.gz	GLPA_MOUSE Glycophorin-A OS=Mus musculus OX=10090 GN=Gypa PE=1 SV=2
10	AFDB:D0PRN4	0.180	0.063	6.766E-1	668	0.177	0.052	D0PRN4.pdb.gz	NRX3B_CHICK Neurexin-3-beta OS=Gallus gallus OX=9031 GN=NRXN3 PE=1 SV=2
11	PDB:5gm6P	0.161	0.134	4.588	246	0.116	0.093	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31431	3.80e-141	393	198	1.000	1.000	SDC4_HUMAN Syndecan-4 OS=Homo sapiens OX=9606 GN=SDC4 PE=1 SV=2
2	P34901	1.92e-98	285	202	0.793	0.777	SDC4_RAT Syndecan-4 OS=Rattus norvegicus OX=10116 GN=Sdc4 PE=1 SV=1
3	O35988	1.50e-97	283	198	0.747	0.747	SDC4_MOUSE Syndecan-4 OS=Mus musculus OX=10090 GN=Sdc4 PE=1 SV=1
4	Q5I5K4	1.08e-55	177	197	0.556	0.558	Q5I5K4_MELGA Syndecan OS=Meleagris gallopavo OX=9103 PE=2 SV=1
5	G3UNU3	2.90e-54	173	196	0.545	0.551	G3UNU3_MELGA Syndecan OS=Meleagris gallopavo OX=9103 PE=3 SV=2
6	Q0JY12	1.84e-25	99.8	201	0.404	0.398	Q0JY12_DANRE Syndecan 4 OS=Danio rerio OX=7955 GN=SDC4 PE=2 SV=1
7	P34900	9.84e-21	87.4	201	0.374	0.368	SDC2_RAT Syndecan-2 OS=Rattus norvegicus OX=10116 GN=Sdc2 PE=1 SV=2
8	P43407	5.66e-20	85.5	202	0.384	0.376	SDC2_MOUSE Syndecan-2 OS=Mus musculus OX=10090 GN=Sdc2 PE=1 SV=1
9	P34741	6.29e-20	85.1	201	0.354	0.348	SDC2_HUMAN Syndecan-2 OS=Homo sapiens OX=9606 GN=SDC2 PE=1 SV=2
10	Q66I66	9.93e-18	79.7	208	0.258	0.245	Q66I66_DANRE Syndecan OS=Danio rerio OX=7955 GN=zgc:103676 PE=2 SV=1
11	Q1AGV7	4.25e-17	77.4	193	0.379	0.389	SDC4A_XENLA Syndecan 4-A OS=Xenopus laevis OX=8355 GN=sdc4-a PE=1 SV=1
12	P26261	2.69e-15	75.1	405	0.172	0.084	SDC3_CHICK Syndecan-3 OS=Gallus gallus OX=9031 GN=SDC3 PE=2 SV=2
13	F1DFN3	3.74e-15	74.7	402	0.202	0.100	F1DFN3_DANRE Syndecan (Fragment) OS=Danio rerio OX=7955 GN=sdc3 PE=2 SV=1
14	Q1AGV6	3.09e-13	67.4	205	0.338	0.327	SDC4B_XENLA Syndecan 4-B OS=Xenopus laevis OX=8355 GN=sdc4-b PE=1 SV=1
15	P18827	4.61e-12	65.5	310	0.227	0.145	SDC1_HUMAN Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3
16	P26260	9.12e-12	64.7	313	0.182	0.115	SDC1_RAT Syndecan-1 OS=Rattus norvegicus OX=10116 GN=Sdc1 PE=1 SV=2
17	P18828	1.10e-11	64.3	311	0.177	0.113	SDC1_MOUSE Syndecan-1 OS=Mus musculus OX=10090 GN=Sdc1 PE=1 SV=1
18	P47951	1.26e-11	64.3	309	0.227	0.146	SDC1_CRIGR Syndecan-1 OS=Cricetulus griseus OX=10029 GN=SDC1 PE=2 SV=1
19	P49415	3.92e-11	63.2	399	0.152	0.075	SDC_DROME Syndecan OS=Drosophila melanogaster OX=7227 GN=Sdc PE=2 SV=2
20	F1MP76	2.75e-06	48.9	346	0.167	0.095	F1MP76_BOVIN Syndecan OS=Bos taurus OX=9913 GN=SDC3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01102 Glycophorin_A	4.2e+02	12.6	Glycophorin A
2	PF01034 Syndecan	3.8e-22	89.3	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361818

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260130	0.999	Syntenin-1
2	9606.ENSP00000346839	0.999	Fibronectin type III domain containing
3	9606.ENSP00000408695	0.999	Protein kinase C alpha type
4	9606.ENSP00000284240	0.998	Thy-1 membrane glycoprotein
5	9606.ENSP00000286201	0.998	Frizzled-7
6	9606.ENSP00000376753	0.998	PDZ domain-containing protein GIPC1
7	9606.ENSP00000264498	0.997	Fibroblast growth factor 2
8	9606.ENSP00000260356	0.990	Thrombospondin-1
9	9606.ENSP00000386884	0.986	C-X-C chemokine receptor type 4
10	9606.ENSP00000306670	0.985	Tudor-interacting repair regulator protein
11	9606.ENSP00000305651	0.983	C-X-C motif chemokine 10
12	9606.ENSP00000355330	0.983	Protein-glutamine gamma-glutamyltransferase 2
13	9606.ENSP00000371420	0.982	Transmembrane glycoprotein NMB
14	9606.ENSP00000379140	0.981	Stromal cell-derived factor 1
15	9606.ENSP00000373905	0.970	Dynamin-2
16	9606.ENSP00000357668	0.965	Disintegrin and metalloproteinase domain-containing protein 12
17	9606.ENSP00000393312	0.960	Fibroblast growth factor receptor 1
18	9606.ENSP00000052754	0.953	Decorin
19	9606.ENSP00000265077	0.953	Versican core protein
20	9606.ENSP00000344468	0.953	Syndecan-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0060089	0.997	molecular transducer activity
GO:0038023	0.991	signaling receptor activity
GO:0070053	0.566	thrombospondin receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0032502	0.976	developmental process
GO:0048856	0.973	anatomical structure development
GO:0050896	0.966	response to stimulus
GO:0048518	0.919	positive regulation of biological process
GO:0048522	0.904	positive regulation of cellular process
GO:0030155	0.896	regulation of cell adhesion
GO:0051128	0.860	regulation of cellular component organization
GO:0048519	0.853	negative regulation of biological process
GO:0007275	0.841	multicellular organism development
GO:0009888	0.836	tissue development
GO:0048523	0.815	negative regulation of cellular process
GO:0042127	0.811	regulation of cell population proliferation
GO:0051239	0.810	regulation of multicellular organismal process
GO:0051241	0.804	negative regulation of multicellular organismal process
GO:0033043	0.789	regulation of organelle organization
GO:0044087	0.744	regulation of cellular component biogenesis
GO:0019222	0.709	regulation of metabolic process
GO:0002682	0.707	regulation of immune system process
GO:0006950	0.699	response to stress
GO:0050865	0.693	regulation of cell activation
GO:0022407	0.693	regulation of cell-cell adhesion
GO:0009653	0.672	anatomical structure morphogenesis
GO:0060255	0.669	regulation of macromolecule metabolic process
GO:0032879	0.654	regulation of localization
GO:0007162	0.647	negative regulation of cell adhesion
GO:0051130	0.645	positive regulation of cellular component organization
GO:0002683	0.633	negative regulation of immune system process
GO:0002694	0.630	regulation of leukocyte activation
GO:0044089	0.620	positive regulation of cellular component biogenesis
GO:0060429	0.602	epithelium development
GO:0051249	0.588	regulation of lymphocyte activation
GO:1903037	0.585	regulation of leukocyte cell-cell adhesion
GO:0022408	0.584	negative regulation of cell-cell adhesion
GO:0050866	0.583	negative regulation of cell activation
GO:0008285	0.572	negative regulation of cell population proliferation
GO:0070663	0.542	regulation of leukocyte proliferation
GO:0080090	0.536	regulation of primary metabolic process
GO:0051171	0.532	regulation of nitrogen compound metabolic process
GO:0009893	0.527	positive regulation of metabolic process
GO:1903038	0.511	negative regulation of leukocyte cell-cell adhesion
GO:0032944	0.509	regulation of mononuclear cell proliferation
GO:0010604	0.498	positive regulation of macromolecule metabolic process
GO:0051049	0.490	regulation of transport
GO:0002695	0.484	negative regulation of leukocyte activation
GO:0050670	0.476	regulation of lymphocyte proliferation
GO:0032945	0.466	negative regulation of mononuclear cell proliferation
GO:0051250	0.457	negative regulation of lymphocyte activation
GO:0031323	0.456	regulation of cellular metabolic process
GO:0050672	0.436	negative regulation of lymphocyte proliferation
GO:0050863	0.432	regulation of T cell activation
GO:0045785	0.392	positive regulation of cell adhesion
GO:0071840	0.380	cellular component organization or biogenesis
GO:2000145	0.359	regulation of cell motility
GO:0001932	0.352	regulation of protein phosphorylation
GO:0042327	0.346	positive regulation of phosphorylation
GO:0010638	0.338	positive regulation of organelle organization
GO:0016043	0.336	cellular component organization
GO:0030334	0.335	regulation of cell migration
GO:0051247	0.335	positive regulation of protein metabolic process
GO:1901888	0.333	regulation of cell junction assembly
GO:0050793	0.332	regulation of developmental process
GO:0044093	0.330	positive regulation of molecular function
GO:0042129	0.316	regulation of T cell proliferation
GO:0050868	0.302	negative regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005886	0.998	plasma membrane
GO:0012505	0.997	endomembrane system
GO:0070013	0.997	intracellular organelle lumen
GO:0043231	0.991	intracellular membrane-bounded organelle
GO:0005576	0.965	extracellular region
GO:0005794	0.941	Golgi apparatus
GO:0031982	0.917	vesicle
GO:0065010	0.914	extracellular membrane-bounded organelle
GO:0005615	0.882	extracellular space
GO:1903561	0.881	extracellular vesicle
GO:0070062	0.755	extracellular exosome
GO:0005796	0.690	Golgi lumen
GO:0005764	0.465	lysosome
GO:0005775	0.455	vacuolar lumen
GO:0043202	0.453	lysosomal lumen
GO:0031981	0.378	nuclear lumen
GO:0030054	0.339	cell junction
GO:0031012	0.314	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]