StarFunc result for job id P31483

User Input

>input (386 residues)
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE
DIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN
WATRKPPAPKSTYESNTKQLSYDEVVNQSSPSNCTVYCGGVTSGLTEQLMRQTFSPFGQI
MEIRVFPDKGYSFVRFNSHESAAHAIVSVNGTTIEGHVVKCYWGKETLDMINPVQQQNQI
GYPQPYGQWGQWYGNAQQIGQYMPNGWQVPAYGMYGQAWNQQGFNQTQSSAPWMGPNYGV
QPPQGQNGSMLPNQPSGYRVAGYETQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31483	1.000	1.000	1.059E-77	386	1.000	1.000	P31483.pdb.gz	TIA1_HUMAN Cytotoxic granule associated RNA binding protein TIA1 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3
2	AFDB:A0A2R8QPL1	0.501	0.501	1.259E-63	386	0.803	0.803	A0A2R8QPL1.pdb.gz
3	AFDB:P70318	0.451	0.444	1.129E-59	392	0.762	0.750	P70318.pdb.gz	TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1
4	AFDB:C9JTN7	0.282	0.374	1.007E-48	285	0.725	0.982	C9JTN7.pdb.gz	C9JTN7_HUMAN TIA1 cytotoxic granule associated RNA binding protein OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=1
5	AFDB:Q95QV8	0.270	0.259	7.888E-40	408	0.399	0.377	Q95QV8.pdb.gz	Q95QV8_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tiar-1 PE=1 SV=1
6	AFDB:Q6YZW2	0.261	0.228	5.767E-33	447	0.324	0.280	Q6YZW2.pdb.gz	RB208_ORYSJ RNA-binding protein 208 OS=Oryza sativa subsp. japonica OX=39947 GN=RBP-208 PE=1 SV=1
7	AFDB:Q9LJH8	0.245	0.224	3.141E-31	427	0.301	0.272	Q9LJH8.pdb.gz	UBP1C_ARATH Oligouridylate-binding protein 1C OS=Arabidopsis thaliana OX=3702 GN=UBP1C PE=1 SV=1
8	AFDB:Q9LQI9	0.246	0.228	1.143E-30	419	0.301	0.277	Q9LQI9.pdb.gz	UBP1B_ARATH Oligouridylate-binding protein 1B OS=Arabidopsis thaliana OX=3702 GN=UBP1B PE=1 SV=1
9	AFDB:Q9LEB3	0.320	0.297	2.390E-30	428	0.275	0.248	Q9LEB3.pdb.gz	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
10	AFDB:P32588	0.224	0.200	3.163E-29	453	0.280	0.238	P32588.pdb.gz	PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUB1 PE=1 SV=4
11	PDB:5vsuA	0.189	0.189	1.751E-18	387	0.119	0.119	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
12	PDB:7oqcF	0.204	0.292	1.147E-16	267	0.166	0.240	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:6y53o	0.217	0.479	1.155E-14	160	0.155	0.375	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	PDB:6r5kH	0.197	0.194	3.401E-13	394	0.184	0.180	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
15	PDB:5lsbA	0.213	0.432	2.152E-12	176	0.098	0.216	5lsbA.pdb.gz
16	PDB:7evoD	0.205	0.390	1.540E-11	200	0.106	0.205	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.194	0.406	1.594E-10	178	0.096	0.208	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.183	0.398	6.973E-10	171	0.104	0.234	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:5yzg1	0.198	0.310	1.707E-8	243	0.124	0.198	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:6qw6R	0.208	0.720	3.797E-8	106	0.083	0.302	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AKZ8	0.0	776	384	0.956	0.961	A0A8I6AKZ8_RAT TIA1 cytotoxic granule-associated RNA binding protein OS=Rattus norvegicus OX=10116 GN=Tia1 PE=4 SV=1
2	A0A8I6AQH6	0.0	719	370	0.912	0.951	A0A8I6AQH6_RAT TIA1 cytotoxic granule-associated RNA binding protein OS=Rattus norvegicus OX=10116 GN=Tia1 PE=4 SV=1
3	A0A8I6GIU6	0.0	564	375	0.738	0.760	A0A8I6GIU6_RAT Tia1 cytotoxic granule-associated RNA binding protein-like 1 OS=Rattus norvegicus OX=10116 GN=Tial1 PE=4 SV=1
4	F7FKD5	0.0	734	377	0.935	0.958	F7FKD5_RAT TIA1 cytotoxic granule-associated RNA binding protein OS=Rattus norvegicus OX=10116 GN=Tia1 PE=4 SV=1
5	F8W8I6	0.0	804	385	0.997	1.000	F8W8I6_HUMAN TIA1 cytotoxic granule associated RNA binding protein OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=1
6	P31483	0.0	810	386	1.000	1.000	TIA1_HUMAN Cytotoxic granule associated RNA binding protein TIA1 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3
7	P52912	0.0	784	386	0.966	0.966	TIA1_MOUSE Cytotoxic granule associated RNA binding protein TIA1 OS=Mus musculus OX=10090 GN=Tia1 PE=1 SV=1
8	P70318	0.0	554	392	0.738	0.727	TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1
9	Q01085	0.0	563	375	0.738	0.760	TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1
10	Q5BJN3	0.0	554	392	0.738	0.727	Q5BJN3_RAT Tia1 cytotoxic granule-associated RNA binding protein-like 1 OS=Rattus norvegicus OX=10116 GN=Tial1 PE=4 SV=1
11	Q5PQR7	0.0	739	375	0.935	0.963	Q5PQR7_RAT RCG56007, isoform CRA_c OS=Rattus norvegicus OX=10116 GN=Tia1 PE=2 SV=1
12	Q7ZVY0	0.0	640	386	0.819	0.819	Q7ZVY0_DANRE Cytotoxic granule-associated RNA binding protein 1 OS=Danio rerio OX=7955 GN=fb73d10 PE=1 SV=1
13	Q80ZW7	0.0	734	377	0.935	0.958	Q80ZW7_MOUSE Cytotoxic granule-associated RNA binding protein 1 OS=Mus musculus OX=10090 GN=Tia1 PE=1 SV=1
14	C9JTN7	1.15e-180	504	285	0.630	0.853	C9JTN7_HUMAN TIA1 cytotoxic granule associated RNA binding protein OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=1
15	A0A8I6AS00	6.74e-179	500	285	0.622	0.842	A0A8I6AS00_RAT TIA1 cytotoxic granule-associated RNA binding protein OS=Rattus norvegicus OX=10116 GN=Tia1 PE=4 SV=1
16	Q9VCE3	5.11e-99	303	464	0.386	0.321	Q9VCE3_DROME Rox8, isoform B OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=1 SV=1
17	Q8SZP5	8.52e-99	303	470	0.386	0.317	Q8SZP5_DROME RE71384p OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=2 SV=1
18	Q8IMX4	8.71e-99	303	470	0.386	0.317	Q8IMX4_DROME FI04408p OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=1 SV=1
19	Q08212	2.89e-97	299	465	0.381	0.316	Q08212_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=Rox8 PE=2 SV=1
20	A0A0G2K1I8	9.27e-94	279	145	0.345	0.917	A0A0G2K1I8_RAT TIA1 cytotoxic granule-associated RNA binding protein OS=Rattus norvegicus OX=10116 GN=Tia1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04847 Calcipressin	3.2	19.0	Calcipressin
2	PF09707 Cas_Cas2CT1978	5e+02	12.2	CRISPR-associated protein (Cas_Cas2CT1978)
3	PF03880 DbpA	14	17.1	DbpA RNA binding domain
4	PF05172 Nup35_RRM	13	17.2	Nup53/35/40-type RNA recognition motif
5	PF14605 Nup35_RRM_2	0.33	22.3	Nup53/35/40-type RNA recognition motif
6	PF14703 PHM7_cyt	0.18	23.5	Cytosolic domain of 10TM putative phosphate transporter
7	PF00076 RRM_1	5.5e-64	223.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
8	PF08777 RRM_3	0.27	22.6	RNA binding motif
9	PF16367 RRM_7	2.3e-06	39.0	RNA recognition motif
10	PF16842 RRM_occluded	4e-09	47.6	Occluded RNA-recognition motif
11	PF11767 SET_assoc	2.1e+02	13.0	Histone lysine methyltransferase SET associated
12	PF14440 XOO_2897-deam	1.2e+02	14.2	Xanthomonas XOO_2897-like deaminase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401371

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244520	0.993	U1 small nuclear ribonucleoprotein C
2	9606.ENSP00000377681	0.957	Ras GTPase-activating protein-binding protein 1
3	9606.ENSP00000361066	0.922	Nuclear receptor coactivator 3
4	9606.ENSP00000368884	0.908	Ribosomal protein S6 kinase alpha-3
5	9606.ENSP00000425561	0.861	Eukaryotic translation initiation factor 4E
6	9606.ENSP00000476046	0.854	mRNA-decapping enzyme 1A
7	9606.ENSP00000340820	0.849	Microtubule-associated protein tau
8	9606.ENSP00000362820	0.849	Serine/arginine-rich splicing factor 3
9	9606.ENSP00000261973	0.833	RNA-binding protein 25
10	9606.ENSP00000349168	0.828	Heterogeneous nuclear ribonucleoprotein H
11	9606.ENSP00000381216	0.827	Far upstream element-binding protein 2
12	9606.ENSP00000352438	0.813	Poly(rC)-binding protein 2
13	9606.ENSP00000340329	0.810	Caprin-1
14	9606.ENSP00000416255	0.810	Eukaryotic translation initiation factor 4 gamma 1
15	9606.ENSP00000352738	0.804	Ras GTPase-activating protein-binding protein 2
16	9606.ENSP00000366843	0.804	Ataxin-2
17	9606.ENSP00000400433	0.797	Heterogeneous nuclear ribonucleoprotein F
18	9606.ENSP00000325376	0.790	Heterogeneous nuclear ribonucleoprotein M
19	9606.ENSP00000313829	0.780	KH domain-containing, RNA-binding, signal transduction-associated protein 1
20	9606.ENSP00000364289	0.777	Nuclear cap-binding protein subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003730	0.999	mRNA 3'-UTR binding
GO:0070717	0.428	poly-purine tract binding
GO:0008143	0.331	poly(A) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.958	positive regulation of biological process
GO:0048522	0.909	positive regulation of cellular process
GO:0009987	0.858	cellular process
GO:0019222	0.855	regulation of metabolic process
GO:0060255	0.846	regulation of macromolecule metabolic process
GO:1904037	0.757	positive regulation of epithelial cell apoptotic process
GO:0031323	0.729	regulation of cellular metabolic process
GO:0080090	0.727	regulation of primary metabolic process
GO:0051171	0.727	regulation of nitrogen compound metabolic process
GO:0010468	0.667	regulation of gene expression
GO:0019219	0.479	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.466	regulation of RNA metabolic process
GO:0008152	0.432	metabolic process
GO:0071704	0.421	organic substance metabolic process
GO:0050896	0.391	response to stimulus
GO:0044238	0.391	primary metabolic process
GO:0006807	0.389	nitrogen compound metabolic process
GO:0043170	0.386	macromolecule metabolic process
GO:1903311	0.352	regulation of mRNA metabolic process
GO:0048519	0.340	negative regulation of biological process
GO:0044237	0.339	cellular metabolic process
GO:0034641	0.314	cellular nitrogen compound metabolic process
GO:0048523	0.303	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0032991	0.994	protein-containing complex
GO:0036464	0.990	cytoplasmic ribonucleoprotein granule
GO:0010494	0.977	cytoplasmic stress granule
GO:0043233	0.957	organelle lumen
GO:0031981	0.946	nuclear lumen
GO:0005654	0.942	nucleoplasm
GO:1990904	0.929	ribonucleoprotein complex
GO:0005829	0.914	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]