StarFunc result for job id P31512

User Input

>input (558 residues)
MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS
ETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC
SFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
SVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKQVFPLNL
ERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLV
RDKLQDRMSPYLVSLWRG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31512	1.000	1.000	0.000	558	1.000	1.000	P31512.pdb.gz	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
2	AFDB:P36367	0.932	0.937	1.913E-103	555	0.832	0.836	P36367.pdb.gz	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
3	AFDB:Q8VHG0	0.918	0.915	2.142E-100	560	0.796	0.793	Q8VHG0.pdb.gz	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
4	AFDB:Q99518	0.867	0.903	8.646E-77	535	0.529	0.551	Q99518.pdb.gz	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
5	AFDB:P31513	0.878	0.919	1.093E-76	532	0.504	0.528	P31513.pdb.gz	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
6	AFDB:Q8K2I3	0.864	0.900	4.449E-76	535	0.518	0.540	Q8K2I3.pdb.gz	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
7	AFDB:Q9EQ76	0.881	0.925	1.203E-75	531	0.502	0.527	Q9EQ76.pdb.gz	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
8	AFDB:A0A024QYY6	0.897	0.938	2.673E-74	533	0.495	0.518	A0A024QYY6.pdb.gz
9	AFDB:P97872	0.889	0.930	3.378E-74	533	0.489	0.512	P97872.pdb.gz	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
10	AFDB:Q95LA2	0.874	0.915	5.719E-74	532	0.502	0.526	Q95LA2.pdb.gz	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
11	PDB:2xlrC	0.547	0.668	5.189E-28	452	0.186	0.230	2xlrC.pdb.gz	Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
12	PDB:2gv8A	0.576	0.718	5.502E-28	442	0.204	0.258	2gv8A.pdb.gz	Mechanism of action of a flavin-containing monooxygenase.
13	PDB:3uozA	0.524	0.540	1.188E-19	540	0.147	0.152	3uozA.pdb.gz	Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
14	PDB:3s5wB	0.463	0.602	1.814E-14	414	0.124	0.167	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
15	PDB:4b65A	0.448	0.534	5.093E-13	456	0.115	0.140	4b65A.pdb.gz	Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
16	PDB:5xhuA	0.262	0.400	7.236E-13	329	0.111	0.188	5xhuA.pdb.gz	Crystal structure of ycgT from bacillus subtilis
17	PDB:4o5qA	0.288	0.305	7.087E-12	521	0.095	0.102	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
18	PDB:3itjB	0.296	0.463	2.567E-11	319	0.077	0.135	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
19	PDB:1f6mA	0.382	0.623	9.861E-11	320	0.102	0.178	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
20	PDB:4g6hA	0.347	0.399	1.246E-10	472	0.111	0.131	4g6hA.pdb.gz	Structural insight into the type-II mitochondrial NADH dehydrogenases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16549	0.0	563	532	0.495	0.519	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	P31512	0.0	1159	558	1.000	1.000	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
3	P31513	0.0	581	532	0.500	0.524	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
4	P36365	0.0	548	532	0.477	0.500	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
5	P36367	0.0	967	555	0.833	0.838	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
6	P49326	0.0	560	533	0.493	0.516	FMO5_HUMAN Flavin-containing monooxygenase 5 OS=Homo sapiens OX=9606 GN=FMO5 PE=1 SV=2
7	P50285	0.0	552	532	0.478	0.502	FMO1_MOUSE Flavin-containing monooxygenase 1 OS=Mus musculus OX=10090 GN=Fmo1 PE=1 SV=1
8	P97872	0.0	566	533	0.489	0.512	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
9	Q01740	0.0	563	532	0.491	0.515	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	Q8K2I3	0.0	609	535	0.525	0.548	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
11	Q8K4C0	0.0	570	533	0.493	0.516	FMO5_RAT Flavin-containing monooxygenase 5 OS=Rattus norvegicus OX=10116 GN=Fmo5 PE=1 SV=3
12	Q8VHG0	0.0	941	560	0.801	0.798	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
13	Q95LA2	0.0	572	532	0.491	0.515	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
14	Q99518	0.0	612	535	0.527	0.550	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
15	Q9EQ76	0.0	590	531	0.500	0.525	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
16	G5EBJ9	4.64e-114	350	529	0.358	0.378	G5EBJ9_CAEEL Flavin-containing monooxygenase OS=Caenorhabditis elegans OX=6239 GN=fmo-2 PE=1 SV=1
17	Q9SXE1	2.84e-38	148	462	0.206	0.249	GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX3 PE=1 SV=1
18	Q6NZ32	1.48e-35	140	449	0.138	0.171	Q6NZ32_DANRE Flavin-containing monooxygenase OS=Danio rerio OX=7955 GN=sb:cb897 PE=1 SV=1
19	Q9SS04	7.31e-35	139	459	0.204	0.248	GSOX1_ARATH Flavin-containing monooxygenase FMO GS-OX1 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX1 PE=1 SV=1
20	Q9W1E9	1.58e-33	134	416	0.138	0.185	Q9W1E9_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	1.8e+02	12.8	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF01262 AlaDh_PNT_C	6.4e+02	11.0	Alanine dehydrogenase/PNT, C-terminal domain
3	PF01266 DAO	0.13	23.4	FAD dependent oxidoreductase
4	PF00743 FMO-like	2.3e-291	978.5	Flavin-binding monooxygenase-like
5	PF13434 Lys_Orn_oxgnase	6.3e-07	40.4	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
6	PF13450 NAD_binding_8	0.48	22.0	NAD(P)-binding Rossmann-like domain
7	PF13454 NAD_binding_9	1.2	20.7	FAD-NAD(P)-binding
8	PF00070 Pyr_redox	13	17.7	Pyridine nucleotide-disulphide oxidoreductase
9	PF07992 Pyr_redox_2	1.6e-05	35.9	Pyridine nucleotide-disulphide oxidoreductase
10	PF13738 Pyr_redox_3	3.4e-12	57.8	Pyridine nucleotide-disulphide oxidoreductase
11	PF01488 Shikimate_DH	1.3e+02	14.0	Shikimate / quinate 5-dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353820	0.932	Cytochrome P450 2D6
2	9606.ENSP00000260682	0.927	Cytochrome P450 2C9
3	9606.ENSP00000337915	0.926	Cytochrome P450 3A4
4	9606.ENSP00000440689	0.620	Cytochrome P450 2E1
5	9606.ENSP00000341292	0.551	Serine/threonine-protein kinase WNK1
6	9606.ENSP00000327453	0.507	Acyl-coenzyme A synthetase ACSM2B, mitochondrial
7	9606.ENSP00000359119	0.504	SRSF protein kinase 3
8	9606.ENSP00000334246	0.500	Cytochrome P450 family 4 subfamily Z member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004497	1.000	monooxygenase activity
GO:0005515	0.998	protein binding
GO:0016705	0.995	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0016709	0.986	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0004499	0.657	N,N-dimethylaniline monooxygenase activity
GO:0036094	0.636	small molecule binding
GO:0097159	0.583	organic cyclic compound binding
GO:1901363	0.510	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0044281	0.974	small molecule metabolic process
GO:1901564	0.924	organonitrogen compound metabolic process
GO:1901360	0.815	organic cyclic compound metabolic process
GO:0046483	0.684	heterocycle metabolic process
GO:0006725	0.663	cellular aromatic compound metabolic process
GO:0034641	0.617	cellular nitrogen compound metabolic process
GO:0042221	0.587	response to chemical
GO:0071466	0.500	cellular response to xenobiotic stimulus
GO:0006793	0.482	phosphorus metabolic process
GO:0006805	0.479	xenobiotic metabolic process
GO:0006796	0.464	phosphate-containing compound metabolic process
GO:0006139	0.458	nucleobase-containing compound metabolic process
GO:0065007	0.433	biological regulation
GO:0006082	0.421	organic acid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.997	membrane
GO:0005789	0.988	endoplasmic reticulum membrane
GO:0031974	0.711	membrane-enclosed lumen
GO:0070013	0.666	intracellular organelle lumen
GO:0005829	0.341	cytosol
GO:0031981	0.316	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	0.995	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.13.-	0.986	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:24468	0.657	H(+) + N,N-dimethylaniline + NADPH + O2 = H2O + N,N-dimethylaniline N-oxide + NADP(+)
EC:1.14.13.8	0.657	flavin-containing monooxygenase.

[back to server]