StarFunc result for job id P31513

User Input

>input (532 residues)
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31513	1.000	1.000	0.000	532	1.000	1.000	P31513.pdb.gz	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
2	AFDB:Q9EQ76	0.988	0.990	0.000	531	0.812	0.814	Q9EQ76.pdb.gz	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
3	AFDB:Q8K2I3	0.934	0.929	4.449E-85	535	0.570	0.566	Q8K2I3.pdb.gz	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
4	AFDB:Q99518	0.935	0.930	6.709E-85	535	0.571	0.568	Q99518.pdb.gz	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
5	AFDB:Q95LA2	0.928	0.928	2.482E-81	532	0.551	0.551	Q95LA2.pdb.gz	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
6	AFDB:P16549	0.925	0.925	3.138E-81	532	0.562	0.562	P16549.pdb.gz	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
7	AFDB:P97872	0.936	0.934	1.015E-80	533	0.538	0.537	P97872.pdb.gz	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
8	AFDB:P36365	0.925	0.925	1.361E-80	532	0.545	0.545	P36365.pdb.gz	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
9	AFDB:Q01740	0.927	0.927	4.401E-80	532	0.545	0.545	Q01740.pdb.gz	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	AFDB:A0A024QYY6	0.939	0.937	1.193E-79	533	0.539	0.538	A0A024QYY6.pdb.gz
11	PDB:2xlrC	0.599	0.700	6.572E-30	452	0.220	0.259	2xlrC.pdb.gz	Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
12	PDB:2gv8A	0.609	0.727	1.758E-28	442	0.209	0.251	2gv8A.pdb.gz	Mechanism of action of a flavin-containing monooxygenase.
13	PDB:3uozA	0.553	0.545	2.109E-20	540	0.145	0.143	3uozA.pdb.gz	Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
14	PDB:3s5wB	0.496	0.617	9.046E-15	414	0.122	0.157	3s5wB.pdb.gz	Two Structures of an N-Hydroxylating Flavoprotein Monooxygenase: ORNITHINE HYDROXYLASE FROM PSEUDOMONAS AERUGINOSA.
15	PDB:5xhuA	0.281	0.412	3.059E-13	329	0.124	0.201	5xhuA.pdb.gz	Crystal structure of ycgT from bacillus subtilis
16	PDB:4o5qA	0.318	0.324	1.180E-12	521	0.113	0.115	4o5qA.pdb.gz	Structure, mechanism and ensemble formation of the alkylhydroperoxide reductase subunits AhpC and AhpF from Escherichia coli
17	PDB:4b65A	0.493	0.563	1.678E-12	456	0.113	0.132	4b65A.pdb.gz	Structural Insight Into the Mechanism of Oxygen Activation and Substrate Selectivity of Flavin-Dependent N-Hydroxylating Monooxygenases.
18	PDB:3itjB	0.323	0.486	1.755E-11	319	0.100	0.166	3itjB.pdb.gz	Insights into the specificity of thioredoxin reductase-thioredoxin interactions. A structural and functional investigation of the yeast thioredoxin system.
19	PDB:1f6mA	0.399	0.619	5.674E-11	320	0.107	0.178	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
20	PDB:2a87A	0.275	0.418	2.063E-10	313	0.105	0.179	2a87A.pdb.gz	Conformational flexibility of Mycobacterium tuberculosis thioredoxin reductase: crystal structure and normal-mode analysis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P16549	0.0	634	532	0.562	0.562	FMO1_PIG Flavin-containing monooxygenase 1 OS=Sus scrofa OX=9823 GN=FMO1 PE=1 SV=3
2	P31512	0.0	603	558	0.524	0.500	FMO4_HUMAN Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Homo sapiens OX=9606 GN=FMO4 PE=1 SV=3
3	P31513	0.0	1105	532	1.000	1.000	FMO3_HUMAN Flavin-containing monooxygenase 3 OS=Homo sapiens OX=9606 GN=FMO3 PE=1 SV=5
4	P36365	0.0	610	532	0.545	0.545	FMO1_RAT Flavin-containing monooxygenase 1 OS=Rattus norvegicus OX=10116 GN=Fmo1 PE=1 SV=2
5	P36367	0.0	590	555	0.539	0.517	FMO4_RABIT Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Oryctolagus cuniculus OX=9986 GN=FMO4 PE=2 SV=2
6	P49326	0.0	578	533	0.528	0.527	FMO5_HUMAN Flavin-containing monooxygenase 5 OS=Homo sapiens OX=9606 GN=FMO5 PE=1 SV=2
7	P50285	0.0	617	532	0.545	0.545	FMO1_MOUSE Flavin-containing monooxygenase 1 OS=Mus musculus OX=10090 GN=Fmo1 PE=1 SV=1
8	P97872	0.0	598	533	0.532	0.531	FMO5_MOUSE Flavin-containing monooxygenase 5 OS=Mus musculus OX=10090 GN=Fmo5 PE=1 SV=4
9	Q01740	0.0	618	532	0.547	0.547	FMO1_HUMAN Flavin-containing monooxygenase 1 OS=Homo sapiens OX=9606 GN=FMO1 PE=1 SV=3
10	Q8K2I3	0.0	661	535	0.573	0.570	FMO2_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 2 OS=Mus musculus OX=10090 GN=Fmo2 PE=1 SV=3
11	Q8K4C0	0.0	599	533	0.528	0.527	FMO5_RAT Flavin-containing monooxygenase 5 OS=Rattus norvegicus OX=10116 GN=Fmo5 PE=1 SV=3
12	Q8VHG0	0.0	585	560	0.523	0.496	FMO4_MOUSE Dimethylaniline monooxygenase [N-oxide-forming] 4 OS=Mus musculus OX=10090 GN=Fmo4 PE=1 SV=3
13	Q95LA2	0.0	615	532	0.551	0.551	FMO1_CANLF Flavin-containing monooxygenase 1 OS=Canis lupus familiaris OX=9615 GN=FMO1 PE=2 SV=3
14	Q99518	0.0	652	535	0.571	0.568	FMO2_HUMAN Flavin-containing monooxygenase 2 OS=Homo sapiens OX=9606 GN=FMO2 PE=1 SV=5
15	Q9EQ76	0.0	940	531	0.812	0.814	FMO3_RAT Flavin-containing monooxygenase 3 OS=Rattus norvegicus OX=10116 GN=Fmo3 PE=1 SV=1
16	G5EBJ9	1.65e-126	382	529	0.387	0.389	G5EBJ9_CAEEL Flavin-containing monooxygenase OS=Caenorhabditis elegans OX=6239 GN=fmo-2 PE=1 SV=1
17	Q9SXE1	1.75e-39	151	462	0.216	0.249	GSOX3_ARATH Flavin-containing monooxygenase FMO GS-OX3 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX3 PE=1 SV=1
18	Q94K43	1.73e-34	137	457	0.226	0.263	GSOX2_ARATH Flavin-containing monooxygenase FMO GS-OX2 OS=Arabidopsis thaliana OX=3702 GN=FMOGS-OX2 PE=1 SV=1
19	Q9LMA1	1.85e-33	135	530	0.259	0.260	FMO1_ARATH Probable flavin-containing monooxygenase 1 OS=Arabidopsis thaliana OX=3702 GN=FMO1 PE=2 SV=1
20	Q7K3U4	6.28e-33	132	429	0.135	0.168	Q7K3U4_DROME Flavin-containing monooxygenase OS=Drosophila melanogaster OX=7227 GN=Fmo-2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	4.3e+02	11.6	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01266 DAO	0.46	21.6	FAD dependent oxidoreductase
3	PF03807 F420_oxidored	6.4e+02	12.4	NADP oxidoreductase coenzyme F420-dependent
4	PF00743 FMO-like	4.2e-297	997.4	Flavin-binding monooxygenase-like
5	PF07991 IlvN	29	15.7	Acetohydroxy acid isomeroreductase, NADPH-binding domain
6	PF13434 Lys_Orn_oxgnase	0.00011	33.1	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
7	PF13241 NAD_binding_7	78	15.1	Putative NAD(P)-binding
8	PF13450 NAD_binding_8	0.034	25.7	NAD(P)-binding Rossmann-like domain
9	PF13454 NAD_binding_9	3.8	19.0	FAD-NAD(P)-binding
10	PF00070 Pyr_redox	0.18	23.7	Pyridine nucleotide-disulphide oxidoreductase
11	PF07992 Pyr_redox_2	2.6e-07	41.8	Pyridine nucleotide-disulphide oxidoreductase
12	PF13738 Pyr_redox_3	2.2e-12	58.5	Pyridine nucleotide-disulphide oxidoreductase
13	PF01488 Shikimate_DH	43	15.6	Shikimate / quinate 5-dehydrogenase
14	PF01946 Thi4	3.5e+02	11.8	Thi4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356729

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337915	0.955	Cytochrome P450 3A4
2	9606.ENSP00000353820	0.948	Cytochrome P450 2D6
3	9606.ENSP00000260682	0.941	Cytochrome P450 2C9
4	9606.ENSP00000483507	0.651	Hydroxyacid oxidase 2
5	9606.ENSP00000333946	0.597	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
6	9606.ENSP00000440689	0.593	Cytochrome P450 2E1
7	9606.ENSP00000209929	0.586	Dimethylaniline monooxygenase [N-oxide-forming] 2
8	9606.ENSP00000265403	0.581	UDP-glucuronosyltransferase 2B10
9	9606.ENSP00000254090	0.561	Dimethylaniline monooxygenase [N-oxide-forming] 5
10	9606.ENSP00000301141	0.544	Cytochrome P450 2A6
11	9606.ENSP00000359507	0.537	Copper homeostasis protein cutC homolog
12	9606.ENSP00000363832	0.517	Aldehyde oxidase
13	9606.ENSP00000342007	0.505	Cytochrome P450 1A2
14	9606.ENSP00000324648	0.503	Cytochrome P450 2B6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016709	0.995	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0005488	0.985	binding
GO:0005515	0.967	protein binding
GO:0043167	0.645	ion binding
GO:0004499	0.639	N,N-dimethylaniline monooxygenase activity
GO:0050661	0.324	NADP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.988	small molecule metabolic process
GO:0044238	0.914	primary metabolic process
GO:0006807	0.809	nitrogen compound metabolic process
GO:1901564	0.755	organonitrogen compound metabolic process
GO:0050896	0.577	response to stimulus
GO:0006082	0.513	organic acid metabolic process
GO:0042221	0.482	response to chemical
GO:0051716	0.475	cellular response to stimulus
GO:1901360	0.474	organic cyclic compound metabolic process
GO:0009058	0.443	biosynthetic process
GO:0006805	0.438	xenobiotic metabolic process
GO:1901576	0.433	organic substance biosynthetic process
GO:0044249	0.390	cellular biosynthetic process
GO:0043436	0.343	oxoacid metabolic process
GO:0044283	0.320	small molecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.998	membrane
GO:0031090	0.994	organelle membrane
GO:0042175	0.968	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.962	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.13.-	0.995	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:24468	0.639	H(+) + N,N-dimethylaniline + NADPH + O2 = H2O + N,N-dimethylaniline N-oxide + NADP(+)
EC:1.14.13.8	0.639	flavin-containing monooxygenase.

[back to server]