StarFunc result for job id P31629

User Input

>input (2446 residues)
MDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSHEGQRQPQIEPEQIGNTAS
AQLFGSGKLASPSEVVQQVAEKQYPPHRPSPYSCQHSLSFPQHSLPQGVMHSTKPHQSLE
GPPWLFPGPLPSVASEDLFPFPIHGHSGGYPRKKISSLNPAYSQYSQKSIEQAEEAHKKE
HKPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHA
HAIKAGLVPFTESAVSKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFAEASDKMSPGPP
IPLDIASRGGYHGSLEESLGGPMKVPILIIPKSGIPLPNESSQYIGPDMLPNPSLNTKAD
DSHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAKS
YEEIIFGKYCRLSPRNALSVTTTSQERAAMGRKGIMEPLPHVNTRLDVKMFEDPVSQLIP
SKGDVDPSQTSMLKSTKFNSESRQPQIIPSSIRNEGKLYPANFQGSNPVLLEAPVDSSPL
IRSNSVPTSSATNLTIPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPS
VQEGHVEVEHHGRMLKGISSSSLKEKKLSPGDRVGYDYDVCRKPYKKWEDSETPKQNYRD
ISCLSSLKHGGEYFMDPVVPLQGVPSMFGTTCENRKRRKEKSVGDEEDTPMICSSIVSTP
VGIMASDYDPKLQMQEGVRSGFAMAGHENLSHGHTERFDPCRPQLQPGSPSLVSEESPSA
IDSDKMSDLGGRKPPGNVISVIQHTNSLSRPNSFERSESAELVACTQDKAPSPSETCDSE
ISEAPVSPEWAPPGDGAESGGKPSPSQQVQQQSYHTQPRLVRQHNIQVPEIRVTEEPDKP
EKEKEAQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFESTG
TGLSRSPSQESNLSHSSSFSMSFEREETSKLSALPKQDEFGKHSEFLTVPAGSYSLSVPG
HHHQKEMRRCSSEQMPCPHPAEVPEVRSKSFDYGNLSHAPVSGAAASTVSPSRERKKCFL
VRQASFSGSPEISQGEVGMDQSVKQEQLEHLHAGLRSGWHHGPPAVLPPLQQEDPGKQVA
GPCPPLSSGPLHLAQPQIMHMDSQESLRNPLIQPTSYMTSKHLPEQPHLFPHQETIPFSP
IQNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPFAQHPQKSYGKPSFQTEIHSSYPLEHV
AEHTGKKPAEYAHTKEQTYPCYSGASGLHPKNLLPKFPSDQSSKSTETPSEQVLQEDFAS
ANAGSLQSLPGTVVPVRIQTHVPSYGSVMYTSISQILGQNSPAIVICKVDENMTQRTLVT
NAAMQGIGFNIAQVLGQHAGLEKYPIWKAPQTLPLGLESSIPLCLPSTSDSVATLGGSKR
MLSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQGC
ASEPKDGLQSGSSSFSSLSPSSSQDYPSVSPSSREPFLPSKEMLSGSRAPLPGQKSSGPS
ESKESSDELDIDETASDMSMSPQSSSLPAGDGQLEEEGKGHKRPVGMLVRMASAPSGNVA
DSTLLLTDMADFQQILQFPSLRTTTTVSWCFLNYTKPNYVQQATFKSSVYASWCISSCNP
NPSGLNTKTTLALLRSKQKITAEIYTLAAMHRPGTGKLTSSSAWKQFTQMKPDASFLFGS
KLERKLVGNILKERGKGDIHGDKDIGSKQTEPIRIKIFEGGYKSNEDYVYVRGRGRGKYI
CEECGIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKAHMKKCLELGV
SMTSVDDTETEEAENLEDLHKAAEKHSMSSISTDHQFSDAEESDGEDGDDNDDDDEDEDD
FDDQGDLTPKTRSRSTSPQPPRFSSLPVNVGAVPHGVPSDSSLGHSSLISYLVTLPSIRV
TQLMTPSDSCEDTQMTEYQRLFQSKSTDSEPDKDRLDIPSCMDEECMLPSEPSSSPRDFS
PSSHHSSPGYDSSPCRDNSPKRYLIPKGDLSPRRHLSPRRDLSPMRHLSPRKEAALRREM
SQRDVSPRRHLSPRRPVSPGKDITARRDLSPRRERRYMTTIRAPSPRRALYHNPPLSMGQ
YLQAEPIVLGPPNLRRGLPQVPYFSLYGDQEGAYEHPGSSLFPEGPNDYVFSHLPLHSQQ
QVRAPIPMVPVGGIQMVHSMPPALSSLHPSPTLPLPMEGFEEKKGASGESFSKDPYVLSK
QHEKRGPHALQSSGPPSTPSSPRLLMKQSTSEDSLNATEREQEENIQTCTKAIASLRIAT
EEAALLGPDQPARVQEPHQNPLGSAHVSIRHFSRPEPGQPCTSATHPDLHDGEKDNFGTS
QTPLAHSTFYSKSCVDDKQLDFHSSKELSSSTEESKDPSSEKSQLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31629	0.999	0.999	0.000	2446	1.000	1.000	P31629.pdb.gz	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
2	AFDB:Q5T1R4	0.148	0.149	6.457E-73	2406	0.350	0.356	Q5T1R4.pdb.gz	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
3	AFDB:A2A884	0.063	0.064	1.342E-66	2348	0.337	0.351	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
4	AFDB:F1M9H4	0.056	0.062	9.023E-45	2110	0.253	0.293	F1M9H4.pdb.gz	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
5	AFDB:O88491	0.030	0.028	1.618E-5	2588	0.143	0.136	O88491.pdb.gz	NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Mus musculus OX=10090 GN=Nsd1 PE=1 SV=1
6	AFDB:F1QI36	0.031	0.043	2.285E-5	1313	0.071	0.132	F1QI36.pdb.gz	F1QI36_DANRE Sal-like protein 1 OS=Danio rerio OX=7955 GN=cb896spalt PE=1 SV=1
7	AFDB:M9NEG1	0.030	0.060	1.936E-4	1109	0.063	0.139	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
8	AFDB:Q9NSC2	0.029	0.044	4.429E-4	1324	0.082	0.151	Q9NSC2.pdb.gz	SALL1_HUMAN Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1 PE=1 SV=2
9	AFDB:Q92766	0.037	0.050	5.084E-4	1687	0.082	0.119	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
10	AFDB:Q62255	0.032	0.046	6.252E-4	1320	0.088	0.164	Q62255.pdb.gz	SALL3_MOUSE Sal-like protein 3 OS=Mus musculus OX=10090 GN=Sall3 PE=1 SV=2
11	PDB:3w5kB	0.016	0.227	2.121E-1	110	0.007	0.155	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5gm6I	0.020	0.272	4.528E-1	102	0.009	0.206	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:7pntO	0.021	0.117	3.121	197	0.006	0.076	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:4v6wCj	0.014	0.127	3.344	92	0.004	0.098	4v6wCj.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:6gawAp	0.020	0.119	4.720	190	0.006	0.074	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
16	PDB:6qx91C	0.013	0.406	5.804	50	0.002	0.120	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:7d58L	0.009	0.264	7.138	47	0.004	0.191	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
18	PDB:7f0rF	0.012	0.072	7.138	278	0.005	0.043	7f0rF.pdb.gz	Pseudomonas aeruginosa SutA wedges RNAP lobe domain open to facilitate promoter DNA unwinding.
19	PDB:6rw4O	0.021	0.116	7.647	194	0.005	0.062	6rw4O.pdb.gz	Distinct pre-initiation steps in human mitochondrial translation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31629	0.0	5010	2446	1.000	1.000	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
2	Q00900	0.0	4168	2437	0.872	0.875	ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Hivep2 PE=1 SV=2
3	Q3UHF7	0.0	4136	2430	0.873	0.879	ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus OX=10090 GN=Hivep2 PE=1 SV=1
4	A2A884	5.57e-125	444	2348	0.167	0.174	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
5	Q03172	4.69e-97	354	2688	0.158	0.144	ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
6	F8VPM9	5.06e-97	354	2688	0.158	0.144	F8VPM9_MOUSE Human immunodeficiency virus type I enhancer binding protein 1 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
7	F1M9H4	3.97e-95	347	2574	0.161	0.153	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
8	Q5T1R4	4.23e-82	305	2406	0.063	0.064	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
9	P15822	2.52e-81	302	2718	0.092	0.083	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
10	F5H212	1.47e-78	293	2717	0.092	0.082	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
11	Q24107	3.40e-46	187	2527	0.046	0.045	Q24107_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
12	Q0E9C5	3.44e-46	187	2532	0.046	0.045	Q0E9C5_DROME Schnurri, isoform A OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
13	A0A0B4KFC0	3.71e-46	187	2587	0.046	0.044	A0A0B4KFC0_DROME Schnurri, isoform F OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
14	Q24605	3.80e-46	187	2529	0.046	0.045	Q24605_DROME Zinc finger protein OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
15	A1Z8F4	3.87e-46	187	2577	0.046	0.044	A1Z8F4_DROME Schnurri, isoform D OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
16	Q7JM44	1.66e-31	138	2242	0.027	0.029	SMA9_CAEEL Transcription factor sma-9 OS=Caenorhabditis elegans OX=6239 GN=sma-9 PE=1 SV=2
17	Q8MQL7	4.40e-22	105	585	0.020	0.085	Q8MQL7_DROME SD06302p OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
18	Q96N95	7.12e-11	68.6	335	0.012	0.087	ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens OX=9606 GN=ZNF396 PE=1 SV=2
19	Q0PCD8	9.88e-11	67.4	273	0.016	0.139	Q0PCD8_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=che-1 PE=4 SV=1
20	Q966L8	1.29e-10	67.0	279	0.016	0.136	CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans OX=6239 GN=che-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11931 SF3a60_Prp9_C	2.2e+02	13.7	SF3a60/Prp9 C-terminal
2	PF00096 zf-C2H2	5.3e-14	62.9	Zinc finger, C2H2 type
3	PF18868 zf-C2H2_3rep	3.6e+02	13.3	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	8.6e-06	37.2	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	1.1e-06	40.0	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	2.4e-08	45.2	Zinc-finger double domain
7	PF13909 zf-H2C2_5	0.016	26.2	C2H2-type zinc-finger domain
8	PF12874 zf-met	96	14.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356575

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363500	0.800	Chloride intracellular channel protein 4
2	9606.ENSP00000359206	0.746	F-box/WD repeat-containing protein 1A
3	9606.ENSP00000350198	0.724	Somatostatin receptor type 2
4	9606.ENSP00000355319	0.713	CLOCK-interacting pacemaker
5	9606.ENSP00000265094	0.699	F-box/WD repeat-containing protein 11
6	9606.ENSP00000002165	0.687	Plasma alpha-L-fucosidase
7	9606.ENSP00000439689	0.685	Transcriptional-regulating factor 1
8	9606.ENSP00000281419	0.681	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2
9	9606.ENSP00000353850	0.666	Integrin beta-1-binding protein 1
10	9606.ENSP00000381382	0.653	Transcription factor 4
11	9606.ENSP00000327255	0.643	Protein phosphatase 1A
12	9606.ENSP00000288221	0.610	ERC protein 2
13	9606.ENSP00000254325	0.603	MHC class II regulatory factor RFX1
14	9606.ENSP00000480836	0.590	Bcl-2-like protein 13
15	9606.ENSP00000310241	0.584	Solute carrier family 22 member 13
16	9606.ENSP00000258042	0.579	Neuromedin-B receptor
17	9606.ENSP00000264933	0.576	Programmed cell death protein 6
18	9606.ENSP00000426568	0.572	Mothers against decapentaplegic homolog 1
19	9606.ENSP00000342560	0.546	Histamine H3 receptor
20	9606.ENSP00000321735	0.538	Monocarboxylate transporter 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003677	1.000	DNA binding
GO:0005515	0.994	protein binding
GO:0140110	0.828	transcription regulator activity
GO:0043565	0.501	sequence-specific DNA binding
GO:0003690	0.471	double-stranded DNA binding
GO:1990837	0.432	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.985	regulation of metabolic process
GO:0009987	0.982	cellular process
GO:0080090	0.980	regulation of primary metabolic process
GO:0060255	0.980	regulation of macromolecule metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0048518	0.955	positive regulation of biological process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.953	regulation of RNA biosynthetic process
GO:0010468	0.927	regulation of gene expression
GO:0048522	0.926	positive regulation of cellular process
GO:0006357	0.916	regulation of transcription by RNA polymerase II
GO:0010604	0.873	positive regulation of macromolecule metabolic process
GO:0031325	0.852	positive regulation of cellular metabolic process
GO:0051173	0.821	positive regulation of nitrogen compound metabolic process
GO:0050896	0.782	response to stimulus
GO:0045893	0.782	positive regulation of DNA-templated transcription
GO:0045944	0.726	positive regulation of transcription by RNA polymerase II
GO:0044238	0.588	primary metabolic process
GO:0071704	0.587	organic substance metabolic process
GO:0044237	0.575	cellular metabolic process
GO:0006807	0.541	nitrogen compound metabolic process
GO:0051716	0.501	cellular response to stimulus
GO:0043170	0.469	macromolecule metabolic process
GO:0023052	0.458	signaling
GO:0007154	0.458	cell communication
GO:0048519	0.455	negative regulation of biological process
GO:0007165	0.422	signal transduction
GO:0048523	0.366	negative regulation of cellular process
GO:0009892	0.304	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005737	0.950	cytoplasm
GO:0005829	0.833	cytosol
GO:0005667	0.395	transcription regulator complex
GO:0016020	0.339	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]