StarFunc result for job id P31639

User Input

>input (672 residues)
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31639	1.000	1.000	4.581E-96	672	1.000	1.000	P31639.pdb.gz	SC5A2_HUMAN Sodium/glucose cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A2 PE=1 SV=1
2	PDB:7vsiA	0.859	0.984	7.651E-69	586	0.871	0.998	7vsiA.pdb.gz	Structural basis of inhibition of the human SGLT2-MAP17 glucose transporter.
3	AFDB:P13866	0.935	0.946	2.567E-66	664	0.583	0.590	P13866.pdb.gz	SC5A1_HUMAN Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1 PE=1 SV=1
4	AFDB:P53790	0.936	0.946	4.650E-66	665	0.591	0.597	P53790.pdb.gz	SC5A1_RAT Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1
5	AFDB:P11170	0.935	0.949	6.530E-66	662	0.586	0.595	P11170.pdb.gz	SC5A1_RABIT Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1
6	AFDB:Q3UNC8	0.943	0.960	6.813E-66	660	0.567	0.577	Q3UNC8.pdb.gz	Q3UNC8_MOUSE Solute carrier family 5 member 4 OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
7	AFDB:D3ZIS0	0.939	0.940	1.947E-64	671	0.551	0.551	D3ZIS0.pdb.gz	SC5A4_RAT Solute carrier family 5 member 4 OS=Rattus norvegicus OX=10116 GN=Slc5a4 PE=3 SV=1
8	AFDB:Q9NY91	0.936	0.954	3.381E-64	659	0.552	0.563	Q9NY91.pdb.gz	SC5A4_HUMAN Probable glucose sensor protein SLC5A4 OS=Homo sapiens OX=9606 GN=SLC5A4 PE=1 SV=1
9	AFDB:Q2M3M2	0.917	0.905	3.040E-62	681	0.534	0.527	Q2M3M2.pdb.gz	SC5A9_HUMAN Sodium/glucose cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC5A9 PE=1 SV=2
10	PDB:7wmvA	0.875	0.976	8.762E-58	602	0.562	0.628	7wmvA.pdb.gz	Structural mechanism of SGLT1 inhibitors.
11	AFDB:Q8K0E3	0.888	0.887	7.643E-57	673	0.507	0.507	Q8K0E3.pdb.gz	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
12	AFDB:Q8WWX8	0.887	0.883	1.029E-56	675	0.503	0.501	Q8WWX8.pdb.gz	SC5AB_HUMAN Sodium/myo-inositol cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A11 PE=1 SV=1
13	PDB:7slaA	0.806	0.921	6.297E-51	585	0.591	0.679	7slaA.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
14	PDB:7sl9A	0.612	0.812	1.342E-14	497	0.161	0.217	7sl9A.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
15	PDB:5j4nA	0.364	0.515	1.311E-4	437	0.101	0.156	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:7dskB	0.350	0.474	3.479E-4	464	0.104	0.151	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
17	PDB:7s1xB	0.328	0.265	3.788E-4	871	0.098	0.076	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:7ccsB	0.292	0.386	2.252E-3	454	0.109	0.161	7ccsB.pdb.gz
19	PDB:7p9uB	0.346	0.475	4.256E-3	455	0.092	0.136	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
20	PDB:7d99A	0.337	0.272	4.834E-3	891	0.115	0.086	7d99A.pdb.gz	Structures and an activation mechanism of human potassium-chloride cotransporters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0PJK1	602	596	0.469	0.529	SC5AA_HUMAN Sodium/mannose cotransporter SLC5A10 OS=Homo sapiens OX=9606 GN=SLC5A10 PE=1 SV=2
2	A0PJT9	782	659	0.577	0.589	A0PJT9_MOUSE Slc5a4b protein OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
3	D3ZIS0	764	671	0.564	0.565	SC5A4_RAT Solute carrier family 5 member 4 OS=Rattus norvegicus OX=10116 GN=Slc5a4 PE=3 SV=1
4	P11170	808	662	0.591	0.600	SC5A1_RABIT Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1
5	P13866	809	664	0.585	0.592	SC5A1_HUMAN Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1 PE=1 SV=1
6	P31637	606	718	0.438	0.409	SC5A3_CANLF Sodium/myo-inositol cotransporter OS=Canis lupus familiaris OX=9615 GN=SLC5A3 PE=1 SV=1
7	P31639	1359	672	1.000	1.000	SC5A2_HUMAN Sodium/glucose cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A2 PE=1 SV=1
8	P53790	791	665	0.597	0.603	SC5A1_RAT Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1
9	P53792	1198	670	0.908	0.910	SC5A2_RAT Sodium/glucose cotransporter 2 OS=Rattus norvegicus OX=10116 GN=Slc5a2 PE=1 SV=1
10	P53794	605	718	0.433	0.405	SC5A3_HUMAN Sodium/myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC5A3 PE=1 SV=3
11	Q2M3M2	699	681	0.542	0.535	SC5A9_HUMAN Sodium/glucose cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC5A9 PE=1 SV=2
12	Q2VPB3	781	657	0.577	0.591	Q2VPB3_MOUSE Slc5a4b protein (Fragment) OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
13	Q3UNC8	781	660	0.576	0.586	Q3UNC8_MOUSE Solute carrier family 5 member 4 OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
14	Q5SWY8	603	596	0.461	0.520	SC5AA_MOUSE Sodium/mannose cotransporter SLC5A10 OS=Mus musculus OX=10090 GN=Slc5a10 PE=1 SV=1
15	Q80WA5	604	718	0.429	0.401	Q80WA5_RAT Sodium myo-inositol transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a3 PE=2 SV=1
16	Q8C3K6	788	665	0.583	0.589	SC5A1_MOUSE Sodium/glucose cotransporter 1 OS=Mus musculus OX=10090 GN=Slc5a1 PE=1 SV=1
17	Q8K0E3	663	673	0.512	0.511	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
18	Q8WWX8	649	675	0.506	0.504	SC5AB_HUMAN Sodium/myo-inositol cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A11 PE=1 SV=1
19	Q91ZP4	785	660	0.579	0.589	S5A4B_MOUSE Solute carrier family 5 member 4B OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=2
20	Q923I7	1205	670	0.908	0.910	SC5A2_MOUSE Sodium/glucose cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00474 SSF	3.3e-166	564.8	Sodium:solute symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327943

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353731	0.910	Dipeptidyl peptidase 4
2	9606.ENSP00000387662	0.861	Glucagon
3	9606.ENSP00000380432	0.860	Insulin
4	9606.ENSP00000362353	0.831	Glucagon-like peptide 1 receptor
5	9606.ENSP00000378187	0.825	Adenylate cyclase type 7
6	9606.ENSP00000323568	0.815	Solute carrier family 2, facilitated glucose transporter member 2
7	9606.ENSP00000264382	0.807	Sucrase-isomaltase, intestinal
8	9606.ENSP00000447378	0.805	Maltase-glucoamylase, intestinal
9	9606.ENSP00000219833	0.773	Sodium-dependent noradrenaline transporter
10	9606.ENSP00000279027	0.739	Solute carrier family 13 member 3
11	9606.ENSP00000272190	0.703	Renin
12	9606.ENSP00000264938	0.688	Sodium/hydrogen exchanger 3
13	9606.ENSP00000290866	0.687	Angiotensin-converting enzyme
14	9606.ENSP00000387760	0.687	Angiotensin-converting enzyme
15	9606.ENSP00000297282	0.682	Solute carrier family 13 member 4
16	9606.ENSP00000416293	0.671	Solute carrier family 2, facilitated glucose transporter member 1
17	9606.ENSP00000231420	0.663	Alanine--glyoxylate aminotransferase 2, mitochondrial
18	9606.ENSP00000323549	0.662	Sodium-dependent neutral amino acid transporter B(0)AT3
19	9606.ENSP00000264784	0.656	Solute carrier family 2, facilitated glucose transporter member 9
20	9606.ENSP00000260649	0.632	Neutral and basic amino acid transport protein rBAT

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015149	1.000	hexose transmembrane transporter activity
GO:0005402	1.000	carbohydrate:monoatomic cation symporter activity
GO:0015370	1.000	solute:sodium symporter activity
GO:0005515	0.996	protein binding
GO:0005355	0.953	glucose transmembrane transporter activity
GO:0005412	0.605	glucose:sodium symporter activity
GO:1901505	0.465	carbohydrate derivative transmembrane transporter activity
GO:0055056	0.418	D-glucose transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0006810	0.996	transport
GO:0008645	0.987	hexose transmembrane transport
GO:1904659	0.818	glucose transmembrane transport
GO:0032501	0.493	multicellular organismal process
GO:0065007	0.424	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.956	organelle
GO:0043227	0.902	membrane-bounded organelle
GO:0005576	0.817	extracellular region
GO:0031982	0.747	vesicle
GO:0043231	0.716	intracellular membrane-bounded organelle
GO:0005615	0.715	extracellular space
GO:0065010	0.688	extracellular membrane-bounded organelle
GO:1903561	0.640	extracellular vesicle
GO:0070062	0.631	extracellular exosome
GO:0098590	0.552	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]