StarFunc result for job id P31641

User Input

>input (620 residues)
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLF
SGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNK
SVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPN
WAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNS
RTVMNGALVKPTHIIVETMM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9MZ34	0.963	0.963	4.696E-79	620	0.903	0.903	Q9MZ34.pdb.gz	SC6A6_BOVIN Sodium- and chloride-dependent taurine transporter OS=Bos taurus OX=9913 GN=SLC6A6 PE=1 SV=1
2	AFDB:O35316	0.936	0.935	1.094E-78	621	0.934	0.932	O35316.pdb.gz	SC6A6_MOUSE Sodium- and chloride-dependent taurine transporter OS=Mus musculus OX=10090 GN=Slc6a6 PE=1 SV=2
3	AFDB:Q2VRP7	0.922	0.914	3.466E-70	625	0.795	0.789	Q2VRP7.pdb.gz	Q2VRP7_DANRE Transporter OS=Danio rerio OX=7955 GN=fc26e12 PE=2 SV=1
4	AFDB:P48066	0.869	0.852	2.677E-59	632	0.576	0.565	P48066.pdb.gz	S6A11_HUMAN Sodium- and chloride-dependent GABA transporter 3 OS=Homo sapiens OX=9606 GN=SLC6A11 PE=2 SV=1
5	AFDB:P31646	0.873	0.899	2.412E-58	602	0.582	0.600	P31646.pdb.gz	S6A13_RAT Sodium- and chloride-dependent GABA transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a13 PE=1 SV=1
6	AFDB:P27799	0.869	0.878	4.950E-58	614	0.568	0.573	P27799.pdb.gz	S6A12_CANLF Sodium- and chloride-dependent betaine transporter OS=Canis lupus familiaris OX=9615 GN=SLC6A12 PE=1 SV=2
7	AFDB:P31651	0.867	0.876	2.468E-57	614	0.571	0.577	P31651.pdb.gz	S6A12_MOUSE Sodium- and chloride-dependent betaine transporter OS=Mus musculus OX=10090 GN=Slc6a12 PE=1 SV=1
8	AFDB:P28570	0.882	0.861	1.921E-55	635	0.532	0.520	P28570.pdb.gz	SC6A8_RAT Sodium- and chloride-dependent creatine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc6a8 PE=1 SV=1
9	AFDB:Q9V4E7	0.863	0.842	4.230E-50	636	0.490	0.478	Q9V4E7.pdb.gz	Q9V4E7_DROME Transporter OS=Drosophila melanogaster OX=7227 GN=Gat PE=1 SV=4
10	AFDB:G5EF43	0.848	0.862	2.835E-49	610	0.455	0.462	G5EF43.pdb.gz	G5EF43_CAEEL Transporter OS=Caenorhabditis elegans OX=6239 GN=snf-11 PE=1 SV=1
11	PDB:6vrhA	0.834	0.953	1.255E-40	541	0.390	0.447	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
12	PDB:7sk2A	0.782	0.904	9.153E-40	532	0.456	0.532	7sk2A.pdb.gz	Structural basis of GABA reuptake inhibition.
13	PDB:7dwxA	0.771	0.789	8.707E-31	605	0.319	0.327	7dwxA.pdb.gz	Structural basis for the different states of the spike protein of SARS-CoV-2 in complex with ACE2.
14	PDB:5j4nA	0.498	0.671	2.598E-6	437	0.092	0.130	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
15	PDB:7s1xB	0.436	0.330	4.897E-6	871	0.090	0.064	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
16	PDB:7dskB	0.499	0.636	5.109E-6	464	0.108	0.144	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
17	PDB:7cmhB	0.439	0.561	2.341E-5	458	0.124	0.168	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
18	PDB:7p9uB	0.415	0.536	3.726E-5	455	0.102	0.138	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
19	PDB:4djiA	0.395	0.465	9.054E-5	493	0.105	0.132	4djiA.pdb.gz
20	PDB:7ccsB	0.407	0.520	9.445E-5	454	0.115	0.156	7ccsB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	G5EF43	563	610	0.460	0.467	G5EF43_CAEEL Transporter OS=Caenorhabditis elegans OX=6239 GN=snf-11 PE=1 SV=1
2	O35316	1146	621	0.934	0.932	SC6A6_MOUSE Sodium- and chloride-dependent taurine transporter OS=Mus musculus OX=10090 GN=Slc6a6 PE=1 SV=2
3	P23978	595	599	0.460	0.476	SC6A1_RAT Sodium- and chloride-dependent GABA transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc6a1 PE=1 SV=1
4	P27799	673	614	0.565	0.570	S6A12_CANLF Sodium- and chloride-dependent betaine transporter OS=Canis lupus familiaris OX=9615 GN=SLC6A12 PE=1 SV=2
5	P28570	623	635	0.524	0.512	SC6A8_RAT Sodium- and chloride-dependent creatine transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc6a8 PE=1 SV=1
6	P30531	596	599	0.461	0.477	SC6A1_HUMAN Sodium- and chloride-dependent GABA transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A1 PE=1 SV=2
7	P31641	1265	620	1.000	1.000	SC6A6_HUMAN Sodium- and chloride-dependent taurine transporter OS=Homo sapiens OX=9606 GN=SLC6A6 PE=1 SV=2
8	P31643	1152	621	0.939	0.937	SC6A6_RAT Sodium- and chloride-dependent taurine transporter OS=Rattus norvegicus OX=10116 GN=Slc6a6 PE=1 SV=1
9	P31646	754	602	0.584	0.601	S6A13_RAT Sodium- and chloride-dependent GABA transporter 2 OS=Rattus norvegicus OX=10116 GN=Slc6a13 PE=1 SV=1
10	P31647	741	627	0.581	0.574	S6A11_RAT Sodium- and chloride-dependent GABA transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc6a11 PE=1 SV=1
11	P31648	595	599	0.460	0.476	SC6A1_MOUSE Sodium- and chloride-dependent GABA transporter 1 OS=Mus musculus OX=10090 GN=Slc6a1 PE=1 SV=2
12	P31649	750	602	0.589	0.606	S6A13_MOUSE Sodium- and chloride-dependent GABA transporter 2 OS=Mus musculus OX=10090 GN=Slc6a13 PE=1 SV=1
13	P31650	742	627	0.592	0.585	S6A11_MOUSE Sodium- and chloride-dependent GABA transporter 3 OS=Mus musculus OX=10090 GN=Slc6a11 PE=1 SV=2
14	P31651	709	614	0.573	0.578	S6A12_MOUSE Sodium- and chloride-dependent betaine transporter OS=Mus musculus OX=10090 GN=Slc6a12 PE=1 SV=1
15	P31661	608	635	0.513	0.501	SC6A8_RABIT Sodium- and chloride-dependent creatine transporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC6A8 PE=1 SV=1
16	P48029	621	635	0.526	0.513	SC6A8_HUMAN Sodium- and chloride-dependent creatine transporter 1 OS=Homo sapiens OX=9606 GN=SLC6A8 PE=1 SV=1
17	P48056	691	614	0.574	0.580	S6A12_RAT Sodium- and chloride-dependent betaine transporter OS=Rattus norvegicus OX=10116 GN=Slc6a12 PE=1 SV=1
18	P48057	582	598	0.455	0.472	SC6A1_MUSCO Sodium- and chloride-dependent GABA transporter 1 OS=Mus cookii OX=10098 GN=Slc6a1 PE=1 SV=1
19	P48065	716	614	0.574	0.580	S6A12_HUMAN Sodium- and chloride-dependent betaine transporter OS=Homo sapiens OX=9606 GN=SLC6A12 PE=1 SV=2
20	P48066	743	632	0.577	0.566	S6A11_HUMAN Sodium- and chloride-dependent GABA transporter 3 OS=Homo sapiens OX=9606 GN=SLC6A11 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00209 SNF	6.9e-237	798.9	Sodium:neurotransmitter symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480890

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267085	0.754	Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L- alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3- sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate
2	9606.ENSP00000328551	0.754	Ras-related protein Rab-28
3	9606.ENSP00000457593	0.681	Nuclear factor of activated T-cells 5
4	9606.ENSP00000306328	0.677	Solute carrier family 25 member 33
5	9606.ENSP00000379616	0.670	Myosin-11
6	9606.ENSP00000386766	0.653	Zinc transporter ZIP10
7	9606.ENSP00000258403	0.646	Thiamine transporter 2
8	9606.ENSP00000478639	0.624	Amino acid transporter
9	9606.ENSP00000370543	0.620	Sodium/myo-inositol cotransporter
10	9606.ENSP00000373073	0.617	Urocanate hydratase 1
11	9606.ENSP00000256689	0.611	Sodium-coupled neutral amino acid transporter 2
12	9606.ENSP00000361895	0.607	Sodium-dependent lysophosphatidylcholine symporter 1
13	9606.ENSP00000282538	0.605	Acidic amino acid decarboxylase GADL1
14	9606.ENSP00000365411	0.602	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
15	9606.ENSP00000285930	0.601	Aldose reductase
16	9606.ENSP00000362294	0.589	Receptor-type tyrosine-protein phosphatase T
17	9606.ENSP00000335261	0.584	Trimethyllysine dioxygenase, mitochondrial
18	9606.ENSP00000326305	0.576	Mitochondrial carnitine/acylcarnitine carrier protein
19	9606.ENSP00000302978	0.568	Protein sprouty homolog 3
20	9606.ENSP00000272542	0.565	Sodium-dependent phosphate transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901682	1.000	sulfur compound transmembrane transporter activity
GO:0042910	1.000	xenobiotic transmembrane transporter activity
GO:0005283	0.999	amino acid:sodium symporter activity
GO:0015378	0.997	sodium:chloride symporter activity
GO:0015185	0.996	gamma-aminobutyric acid transmembrane transporter activity
GO:0140161	0.996	monocarboxylate:sodium symporter activity
GO:0005488	0.953	binding
GO:0005515	0.917	protein binding
GO:0015175	0.450	neutral L-amino acid transmembrane transporter activity
GO:0015179	0.339	L-amino acid transmembrane transporter activity
GO:0005332	0.302	gamma-aminobutyric acid:sodium:chloride symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0071702	0.989	organic substance transport
GO:0072348	0.972	sulfur compound transport
GO:0071705	0.966	nitrogen compound transport
GO:0015711	0.962	organic anion transport
GO:0015849	0.958	organic acid transport
GO:0009987	0.884	cellular process
GO:0006865	0.706	amino acid transport
GO:0065007	0.516	biological regulation
GO:0055085	0.305	transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.604	intracellular anatomical structure
GO:0005737	0.547	cytoplasm
GO:0098590	0.515	plasma membrane region
GO:0043226	0.461	organelle
GO:0042995	0.402	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29823	0.997	chloride(in) = chloride(out)

[back to server]