StarFunc result for job id P31689

User Input

>input (397 residues)
MVKETTYYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEGEKFKQISQAYEVLSDAKK
RELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGGRMQRERRGKNVVHQLSVTLEDLYN
GATRKLALQKNVICDKCEGRGGKKGAVECCPNCRGTGMQIRIHQIGPGMVQQIQSVCMEC
QGHGERISPKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGLEPGDII
IVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRTIVITSHPGQIVKHGDI
KCVLNEGMPIYRRPYEKGRLIIEFKVNFPENGFLSPDKLSLLEKLLPERKEVEETDEMDQ
VELVDFDPNQERRRHYNGEAYEDDEHHPRGGVQCQTS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31689	1.000	1.000	3.642E-84	397	1.000	1.000	P31689.pdb.gz	DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2
2	AFDB:Q864B5	0.707	0.707	6.950E-70	397	0.741	0.741	Q864B5.pdb.gz	Q864B5_PIG PDJA1 chaperone OS=Sus scrofa OX=9823 PE=1 SV=1
3	AFDB:O35824	0.691	0.670	2.013E-59	412	0.567	0.546	O35824.pdb.gz	DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Dnaja2 PE=1 SV=1
4	AFDB:O45502	0.593	0.586	2.984E-57	402	0.519	0.512	O45502.pdb.gz	O45502_CAEEL DNaJ domain (Prokaryotic heat shock protein) OS=Caenorhabditis elegans OX=6239 GN=dnj-12 PE=1 SV=1
5	AFDB:Q54VQ1	0.697	0.674	1.192E-56	411	0.524	0.506	Q54VQ1.pdb.gz	Q54VQ1_DICDI Heat shock protein OS=Dictyostelium discoideum OX=44689 GN=ddj1 PE=3 SV=1
6	AFDB:A0A1D8PSQ3	0.658	0.664	5.298E-55	393	0.486	0.491	A0A1D8PSQ3.pdb.gz	A0A1D8PSQ3_CANAL Type I HSP40 co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YDJ1 PE=3 SV=1
7	AFDB:O74752	0.672	0.657	5.627E-55	407	0.489	0.477	O74752.pdb.gz	MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mas5 PE=3 SV=1
8	AFDB:P25491	0.665	0.646	1.475E-54	409	0.481	0.467	P25491.pdb.gz	MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDJ1 PE=1 SV=1
9	AFDB:U5HUF9	0.670	0.635	2.354E-53	420	0.491	0.464	U5HUF9.pdb.gz	U5HUF9_NICBE MIP1.1a OS=Nicotiana benthamiana OX=4100 GN=MIP1 PE=2 SV=1
10	AFDB:Q94AW8	0.669	0.634	1.197E-52	420	0.494	0.467	Q94AW8.pdb.gz	DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana OX=3702 GN=ATJ3 PE=1 SV=2
11	PDB:6byrA	0.153	0.151	1.332E-4	405	0.098	0.096	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
12	PDB:7x3kA	0.150	0.224	3.052E-3	262	0.071	0.107	7x3kA.pdb.gz
13	PDB:5y88T	0.132	0.430	7.532E-3	107	0.065	0.243	5y88T.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
14	PDB:2y4uA	0.130	0.122	9.584E-3	424	0.073	0.068	2y4uA.pdb.gz
15	PDB:7sqcO1	0.117	0.086	6.199E-2	673	0.086	0.051	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
16	PDB:7sqcO0	0.128	0.069	6.993E-2	1140	0.103	0.036	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:4n2oA	0.110	0.193	2.477E-1	195	0.045	0.092	4n2oA.pdb.gz
18	PDB:5n4lA	0.107	0.050	4.523E-1	1034	0.053	0.020	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
19	PDB:5zx3C	0.067	0.035	6.113E-1	1105	0.093	0.033	5zx3C.pdb.gz	Structural basis for transcription initiation by bacterial ECF sigma factors.
20	PDB:7q1yA	0.072	0.031	9.896E-1	1374	0.050	0.015	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31689	0.0	813	397	1.000	1.000	DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens OX=9606 GN=DNAJA1 PE=1 SV=2
2	P63036	0.0	811	397	0.995	0.995	DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Dnaja1 PE=1 SV=1
3	P63037	0.0	811	397	0.995	0.995	DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus OX=10090 GN=Dnaja1 PE=1 SV=1
4	Q864B5	0.0	586	397	0.736	0.736	Q864B5_PIG PDJA1 chaperone OS=Sus scrofa OX=9823 PE=1 SV=1
5	Q8WW22	0.0	584	397	0.736	0.736	DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens OX=9606 GN=DNAJA4 PE=1 SV=1
6	O60884	4.91e-137	399	412	0.557	0.536	DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1
7	O35824	2.28e-136	397	412	0.554	0.534	DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus OX=10116 GN=Dnaja2 PE=1 SV=1
8	Q54VQ1	1.14e-124	368	411	0.524	0.506	Q54VQ1_DICDI Heat shock protein OS=Dictyostelium discoideum OX=44689 GN=ddj1 PE=3 SV=1
9	U5HUF9	5.73e-121	358	420	0.514	0.486	U5HUF9_NICBE MIP1.1a OS=Nicotiana benthamiana OX=4100 GN=MIP1 PE=2 SV=1
10	O45502	7.37e-121	358	402	0.509	0.502	O45502_CAEEL DNaJ domain (Prokaryotic heat shock protein) OS=Caenorhabditis elegans OX=6239 GN=dnj-12 PE=1 SV=1
11	P42825	6.83e-120	356	419	0.509	0.482	DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis thaliana OX=3702 GN=ATJ2 PE=1 SV=2
12	A0A1D8PSQ3	1.73e-117	349	393	0.481	0.486	A0A1D8PSQ3_CANAL Type I HSP40 co-chaperone OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YDJ1 PE=3 SV=1
13	P25491	1.35e-112	337	409	0.479	0.465	MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDJ1 PE=1 SV=1
14	O74752	1.83e-112	337	407	0.479	0.467	MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mas5 PE=3 SV=1
15	Q94AW8	3.33e-112	336	420	0.501	0.474	DNAJ3_ARATH Chaperone protein dnaJ 3 OS=Arabidopsis thaliana OX=3702 GN=ATJ3 PE=1 SV=2
16	Q585V4	2.94e-99	303	404	0.441	0.433	Q585V4_TRYB2 Chaperone protein DnaJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30J2.30 PE=3 SV=1
17	O16303	3.16e-93	288	439	0.466	0.421	O16303_CAEEL DNaJ domain (Prokaryotic heat shock protein) OS=Caenorhabditis elegans OX=6239 GN=dnj-19 PE=1 SV=1
18	Q38C15	4.59e-92	285	416	0.395	0.377	Q38C15_TRYB2 Chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5440 PE=3 SV=1
19	O94657	6.18e-72	233	413	0.355	0.341	XDJ1_SCHPO DnaJ protein homolog xdj1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=xdj1 PE=3 SV=1
20	Q9LZK5	2.59e-61	203	346	0.345	0.396	DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana OX=3702 GN=ERDJ3B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15777 Anti-TRAP	1.3e+02	14.0	Tryptophan RNA-binding attenuator protein inhibitory protein
2	PF00226 DnaJ	1.5e-23	94.0	DnaJ domain
3	PF01556 DnaJ_C	6.9e-41	151.3	DnaJ C terminal domain
4	PF00684 DnaJ_CXXCXGXG	5.7e-11	53.9	DnaJ central domain
5	PF01155 HypA	1.5e+02	13.8	Hydrogenase/urease nickel incorporation, metallochaperone, hypA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010617499.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010616350.1	0.955	Heat shock cognate 71 kDa protein
2	885580.XP_010622182.1	0.936	Heat shock protein 105 kDa
3	885580.XP_010638140.1	0.906	Heat shock 70 kDa protein 4
4	885580.XP_010634407.1	0.872	Stress-induced-phosphoprotein 1
5	885580.XP_010601324.1	0.866	Heat shock-related 70 kDa protein 2
6	885580.XP_010608185.1	0.847	Heat shock 70 kDa protein 1-like
7	885580.XP_010608231.1	0.847	Heat shock 70 kDa protein 1B
8	885580.XP_010608232.1	0.845	Heat shock 70 kDa protein 1B-like
9	885580.XP_010605523.1	0.834	Heat shock protein HSP 90-alpha
10	885580.XP_010617152.1	0.813	Heat shock 70 kDa protein 4L isoform X1
11	885580.XP_010635235.1	0.801	Suppressor of G2 allele of SKP1 like protein
12	885580.XP_010611751.1	0.798	PDZ domain-containing protein GIPC1
13	885580.XP_010643967.1	0.796	Heat shock 70 kDa protein 13
14	885580.XP_010611834.1	0.792	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 36 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 16 samples with support for all annotated introns
15	885580.XP_010615413.1	0.786	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 5 bases in 5 codons
16	885580.XP_010612084.1	0.782	Stress-70 protein, mitochondrial
17	885580.XP_010635348.1	0.781	dnaJ homolog subfamily C member 2
18	885580.XP_010640270.1	0.780	Histone-lysine N-methyltransferase
19	885580.XP_010616035.1	0.770	Heat shock protein HSP 90-beta
20	885580.XP_010633139.1	0.755	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0060590	0.952	ATPase regulator activity
GO:0001671	0.881	ATPase activator activity
GO:0051087	0.779	chaperone binding
GO:0019899	0.705	enzyme binding
GO:0031072	0.398	heat shock protein binding
GO:0005102	0.390	signaling receptor binding
GO:0031625	0.389	ubiquitin protein ligase binding
GO:0030544	0.354	Hsp70 protein binding
GO:0140297	0.340	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0065007	0.993	biological regulation
GO:0050794	0.978	regulation of cellular process
GO:0050896	0.888	response to stimulus
GO:0008152	0.695	metabolic process
GO:0071704	0.687	organic substance metabolic process
GO:0042221	0.662	response to chemical
GO:0044238	0.651	primary metabolic process
GO:0006807	0.643	nitrogen compound metabolic process
GO:0019222	0.593	regulation of metabolic process
GO:0043170	0.550	macromolecule metabolic process
GO:0051179	0.538	localization
GO:0044237	0.535	cellular metabolic process
GO:0060255	0.524	regulation of macromolecule metabolic process
GO:0048518	0.497	positive regulation of biological process
GO:0080090	0.488	regulation of primary metabolic process
GO:0048519	0.486	negative regulation of biological process
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0048523	0.484	negative regulation of cellular process
GO:0006950	0.479	response to stress
GO:0006457	0.474	protein folding
GO:0031323	0.465	regulation of cellular metabolic process
GO:0048522	0.459	positive regulation of cellular process
GO:0051716	0.447	cellular response to stimulus
GO:0010468	0.405	regulation of gene expression
GO:1901564	0.397	organonitrogen compound metabolic process
GO:0071840	0.379	cellular component organization or biogenesis
GO:0009893	0.358	positive regulation of metabolic process
GO:0010604	0.352	positive regulation of macromolecule metabolic process
GO:0016043	0.349	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0012505	0.982	endomembrane system
GO:0016020	0.964	membrane
GO:0005576	0.962	extracellular region
GO:0070013	0.943	intracellular organelle lumen
GO:0032991	0.909	protein-containing complex
GO:0070062	0.909	extracellular exosome
GO:0005634	0.805	nucleus
GO:0043232	0.756	intracellular non-membrane-bounded organelle
GO:0031090	0.456	organelle membrane
GO:0031981	0.451	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]