StarFunc result for job id P31749

User Input

>input (480 residues)
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0LPE5	0.952	0.952	4.618E-82	480	1.000	1.000	B0LPE5.pdb.gz	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
2	AFDB:M4MD44	0.907	0.918	8.218E-78	474	0.879	0.890	M4MD44.pdb.gz	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
3	AFDB:A0A0B8RZS0	0.925	0.923	5.226E-75	481	0.812	0.811	A0A0B8RZS0.pdb.gz	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
4	AFDB:Q8UUX0	0.934	0.936	5.226E-75	479	0.794	0.795	Q8UUX0.pdb.gz	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
5	AFDB:F1MYJ4	0.905	0.907	1.251E-73	479	0.825	0.827	F1MYJ4.pdb.gz	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
6	AFDB:Q8INB9	0.886	0.702	5.415E-65	611	0.613	0.481	Q8INB9.pdb.gz	AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Akt PE=1 SV=3
7	AFDB:Q17941	0.853	0.761	5.959E-60	541	0.579	0.514	Q17941.pdb.gz	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
8	PDB:6s9wA	0.559	0.645	1.242E-59	411	0.850	0.993	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
9	AFDB:Q9XTG7	0.812	0.743	1.371E-59	528	0.540	0.491	Q9XTG7.pdb.gz	AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans OX=6239 GN=akt-2 PE=1 SV=1
10	PDB:6hhgA	0.544	0.667	1.914E-56	386	0.802	0.997	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
11	PDB:5kcvA	0.540	0.725	7.146E-53	353	0.717	0.975	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
12	AFDB:P54644	0.666	0.719	2.990E-46	444	0.410	0.444	P54644.pdb.gz	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
13	AFDB:G8JY36	0.666	0.444	3.384E-39	725	0.358	0.237	G8JY36.pdb.gz	G8JY36_CAEEL Protein kinase C OS=Caenorhabditis elegans OX=6239 GN=pkc-2 PE=1 SV=1
14	PDB:6byrA	0.606	0.715	4.687E-31	405	0.296	0.351	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
15	PDB:3pfqA	0.615	0.565	4.937E-31	523	0.338	0.310	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
16	PDB:5x3fB	0.558	0.759	9.597E-30	349	0.275	0.378	5x3fB.pdb.gz
17	PDB:6pjxA	0.588	0.522	2.391E-27	543	0.246	0.217	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.
18	PDB:4yhjA	0.598	0.574	8.340E-27	501	0.235	0.226	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:3pvuA	0.558	0.444	9.750E-27	609	0.227	0.179	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:3nynA	0.594	0.517	1.027E-26	554	0.240	0.208	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B8RZS0	837	481	0.815	0.813	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
2	B0LPE5	1004	480	1.000	1.000	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
3	C1PIG3	977	480	0.971	0.971	C1PIG3_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
4	E1B9D1	742	438	0.740	0.811	E1B9D1_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT2 PE=3 SV=2
5	F1MYJ4	826	479	0.827	0.829	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
6	G3X7B5	978	480	0.973	0.973	G3X7B5_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=3 SV=2
7	G9BWQ1	979	480	0.973	0.973	G9BWQ1_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
8	G9BWQ2	837	481	0.815	0.813	G9BWQ2_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=AKT2 PE=2 SV=1
9	J3QKW1	686	396	0.685	0.831	J3QKW1_HUMAN AKT serine/threonine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
10	M0R0P9	700	450	0.694	0.740	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
11	M4MD44	881	474	0.881	0.892	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
12	O57513	969	480	0.960	0.960	O57513_CHICK RAC-alpha serine/threonine-protein kinase OS=Gallus gallus OX=9031 GN=akt1 PE=1 SV=1
13	P31749	1004	480	1.000	1.000	AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2
14	P31750	989	480	0.983	0.983	AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt1 PE=1 SV=2
15	P31751	836	481	0.815	0.813	AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
16	P47196	988	480	0.981	0.981	AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt1 PE=1 SV=1
17	P47197	833	481	0.812	0.811	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
18	Q01314	974	480	0.969	0.969	AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=1 SV=2
19	Q17941	568	541	0.581	0.516	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
20	Q60823	837	481	0.817	0.815	AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	3.1e+02	11.9	ABC1 atypical kinase-like domain
2	PF01636 APH	3.2e+02	12.6	Phosphotransferase enzyme family
3	PF14531 Kinase-like	4e-05	34.7	Kinase-like
4	PF00169 PH	3.6e-13	61.3	PH domain
5	PF15413 PH_11	12	17.8	Pleckstrin homology domain
6	PF20399 PH_20	17	16.9	PH domain
7	PF00069 Pkinase	5.8e-74	260.4	Protein kinase domain
8	PF00433 Pkinase_C	1.4e-05	37.0	Protein kinase C terminal domain
9	PF17667 Pkinase_fungal	2.4e+02	11.9	Fungal protein kinase
10	PF07714 PK_Tyr_Ser-Thr	4.5e-32	122.9	Protein tyrosine and serine/threonine kinase
11	PF07387 Seadorna_VP7	1.6e+02	12.7	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019838

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011677	0.999	Serine/threonine-protein kinase mTOR
2	61853.ENSNLEP00000019365	0.998	Heat shock protein 90kDa alpha (cytosolic), class A member 1
3	61853.ENSNLEP00000001356	0.995	Forkhead box O1
4	61853.ENSNLEP00000004551	0.995	MDM2 proto-oncogene, E3 ubiquitin protein ligase
5	61853.ENSNLEP00000004866	0.995	Nitric oxide synthase
6	61853.ENSNLEP00000006160	0.995	Glycogen synthase kinase 3 beta
7	61853.ENSNLEP00000015110	0.994	Forkhead box O3
8	61853.ENSNLEP00000018084	0.994	Mitogen-activated protein kinase kinase kinase 5
9	61853.ENSNLEP00000004343	0.991	Cyclin-dependent kinase inhibitor 1B (p27, Kip1)
10	61853.ENSNLEP00000005992	0.989	BCL2-associated agonist of cell death
11	61853.ENSNLEP00000012567	0.989	Thioesterase superfamily member 4
12	61853.ENSNLEP00000021181	0.989	Integrin-linked kinase
13	61853.ENSNLEP00000005755	0.987	Raf-1 proto-oncogene, serine/threonine kinase
14	61853.ENSNLEP00000006936	0.987	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha
15	61853.ENSNLEP00000015722	0.987	Tuberous sclerosis 1
16	61853.ENSNLEP00000017924	0.987	Conserved helix-loop-helix ubiquitous kinase
17	61853.ENSNLEP00000012897	0.986	annotation not available
18	61853.ENSNLEP00000022745	0.985	Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
19	61853.ENSNLEP00000000583	0.984	T-cell leukemia/lymphoma 1A
20	61853.ENSNLEP00000010575	0.984	PH domain and leucine rich repeat protein phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0004674	0.994	protein serine/threonine kinase activity
GO:0043167	0.743	ion binding
GO:0043168	0.615	anion binding
GO:0019899	0.551	enzyme binding
GO:0019901	0.418	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.983	cellular process
GO:0009719	0.981	response to endogenous stimulus
GO:0050794	0.979	regulation of cellular process
GO:0010243	0.978	response to organonitrogen compound
GO:1901700	0.975	response to oxygen-containing compound
GO:1901652	0.974	response to peptide
GO:0051716	0.922	cellular response to stimulus
GO:0043434	0.922	response to peptide hormone
GO:0048518	0.918	positive regulation of biological process
GO:0071375	0.838	cellular response to peptide hormone stimulus
GO:0008152	0.741	metabolic process
GO:0044237	0.706	cellular metabolic process
GO:0071704	0.704	organic substance metabolic process
GO:0044238	0.684	primary metabolic process
GO:0006807	0.679	nitrogen compound metabolic process
GO:0048522	0.676	positive regulation of cellular process
GO:0019222	0.657	regulation of metabolic process
GO:0007154	0.606	cell communication
GO:0060255	0.587	regulation of macromolecule metabolic process
GO:1901564	0.575	organonitrogen compound metabolic process
GO:0023052	0.573	signaling
GO:0043170	0.570	macromolecule metabolic process
GO:0080090	0.561	regulation of primary metabolic process
GO:0031323	0.557	regulation of cellular metabolic process
GO:0048519	0.547	negative regulation of biological process
GO:0051171	0.517	regulation of nitrogen compound metabolic process
GO:0019538	0.516	protein metabolic process
GO:0007165	0.489	signal transduction
GO:0048523	0.451	negative regulation of cellular process
GO:0048583	0.426	regulation of response to stimulus
GO:0009893	0.413	positive regulation of metabolic process
GO:0023051	0.405	regulation of signaling
GO:0010646	0.404	regulation of cell communication
GO:0009966	0.393	regulation of signal transduction
GO:0032502	0.387	developmental process
GO:0031325	0.379	positive regulation of cellular metabolic process
GO:0010604	0.355	positive regulation of macromolecule metabolic process
GO:0048856	0.347	anatomical structure development
GO:0051173	0.340	positive regulation of nitrogen compound metabolic process
GO:0036211	0.313	protein modification process
GO:0009889	0.308	regulation of biosynthetic process
GO:0031326	0.300	regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	0.995	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005886	0.989	plasma membrane
GO:0005829	0.987	cytosol
GO:0043232	0.897	intracellular non-membrane-bounded organelle
GO:0032991	0.593	protein-containing complex
GO:0015630	0.361	microtubule cytoskeleton
GO:0031982	0.302	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.994	Phosphotransferases with an alcohol group as acceptor.

[back to server]