StarFunc result for job id P31751

User Input

>input (481 residues)
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTTEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0B8RZS0	0.917	0.917	3.801E-82	481	0.985	0.985	A0A0B8RZS0.pdb.gz	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
2	AFDB:Q8UUX0	0.947	0.951	7.984E-81	479	0.861	0.864	Q8UUX0.pdb.gz	Q8UUX0_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=cb945 PE=1 SV=1
3	AFDB:B0LPE5	0.876	0.878	2.368E-72	480	0.811	0.812	B0LPE5.pdb.gz	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
4	AFDB:F1MYJ4	0.902	0.905	4.631E-72	479	0.778	0.781	F1MYJ4.pdb.gz	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
5	AFDB:M4MD44	0.830	0.842	1.113E-71	474	0.780	0.791	M4MD44.pdb.gz	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
6	AFDB:Q8INB9	0.825	0.659	6.537E-65	611	0.628	0.494	Q8INB9.pdb.gz	AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Akt PE=1 SV=3
7	AFDB:M0R0P9	0.671	0.717	1.153E-64	450	0.821	0.878	M0R0P9.pdb.gz	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
8	AFDB:Q17941	0.896	0.799	8.978E-62	541	0.561	0.499	Q17941.pdb.gz	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
9	AFDB:Q9XTG7	0.886	0.809	2.394E-61	528	0.549	0.500	Q9XTG7.pdb.gz	AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans OX=6239 GN=akt-2 PE=1 SV=1
10	PDB:6s9wA	0.539	0.625	4.372E-54	411	0.726	0.849	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
11	PDB:6hhgA	0.528	0.649	1.039E-51	386	0.692	0.863	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
12	PDB:5kcvA	0.522	0.703	2.155E-48	353	0.632	0.861	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
13	AFDB:P54644	0.668	0.723	5.185E-48	444	0.403	0.437	P54644.pdb.gz	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
14	PDB:3pfqA	0.646	0.595	1.000E-32	523	0.337	0.310	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
15	PDB:6byrA	0.620	0.732	9.884E-31	405	0.283	0.336	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
16	PDB:5x3fB	0.556	0.758	6.137E-29	349	0.252	0.347	5x3fB.pdb.gz
17	PDB:4mk0A	0.590	0.455	2.118E-28	631	0.245	0.187	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:4yhjA	0.614	0.590	3.200E-28	501	0.252	0.242	4yhjA.pdb.gz	Structure and Function of the Hypertension Variant A486V of G Protein-coupled Receptor Kinase 4.
19	PDB:3pvuA	0.577	0.460	5.945E-28	609	0.241	0.190	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:3nynA	0.620	0.541	2.522E-27	554	0.256	0.222	3nynA.pdb.gz	Molecular basis for activation of G protein-coupled receptor kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B8RZS0	993	481	0.985	0.985	A0A0B8RZS0_PIG non-specific serine/threonine protein kinase OS=Sus scrofa domesticus OX=9825 GN=AKT2 PE=3 SV=1
2	B0LPE5	836	480	0.813	0.815	B0LPE5_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=1
3	C1PIG3	837	480	0.817	0.819	C1PIG3_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
4	E1B9D1	884	438	0.898	0.986	E1B9D1_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT2 PE=3 SV=2
5	F1MYJ4	786	479	0.778	0.781	F1MYJ4_BOVIN non-specific serine/threonine protein kinase OS=Bos taurus OX=9913 GN=AKT3 PE=3 SV=2
6	G3X7B5	837	480	0.815	0.817	G3X7B5_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=3 SV=2
7	G9BWQ1	838	480	0.819	0.821	G9BWQ1_PIG RAC-alpha serine/threonine-protein kinase OS=Sus scrofa OX=9823 GN=AKT1 PE=2 SV=1
8	G9BWQ2	993	481	0.985	0.985	G9BWQ2_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=AKT2 PE=2 SV=1
9	J3QKW1	812	396	0.821	0.997	J3QKW1_HUMAN AKT serine/threonine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
10	M0R0P9	818	450	0.821	0.878	M0R0P9_HUMAN non-specific serine/threonine protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=1
11	M4MD44	796	474	0.782	0.793	M4MD44_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=akt1 PE=1 SV=1
12	O57513	848	480	0.823	0.825	O57513_CHICK RAC-alpha serine/threonine-protein kinase OS=Gallus gallus OX=9031 GN=akt1 PE=1 SV=1
13	P31749	836	480	0.813	0.815	AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1 PE=1 SV=2
14	P31750	840	480	0.815	0.817	AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt1 PE=1 SV=2
15	P31751	1004	481	1.000	1.000	AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT2 PE=1 SV=2
16	P47196	839	480	0.815	0.817	AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt1 PE=1 SV=1
17	P47197	981	481	0.977	0.977	AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Akt2 PE=1 SV=1
18	Q01314	840	480	0.817	0.819	AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus OX=9913 GN=AKT1 PE=1 SV=2
19	Q17941	566	541	0.561	0.499	AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans OX=6239 GN=akt-1 PE=1 SV=2
20	Q60823	985	481	0.981	0.981	AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Akt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	4e+02	11.5	ABC1 atypical kinase-like domain
2	PF13095 FTA2	3.8e+02	12.1	Kinetochore Sim4 complex subunit FTA2
3	PF14531 Kinase-like	6e-06	37.4	Kinase-like
4	PF00169 PH	4.9e-14	64.1	PH domain
5	PF15413 PH_11	4e+02	12.9	Pleckstrin homology domain
6	PF20399 PH_20	0.49	21.8	PH domain
7	PF00069 Pkinase	2e-74	261.9	Protein kinase domain
8	PF00433 Pkinase_C	0.0012	30.8	Protein kinase C terminal domain
9	PF07714 PK_Tyr_Ser-Thr	6.8e-34	128.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375892

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000385824	0.993	Forkhead box protein O3
2	9606.ENSP00000288266	0.991	DCC-interacting protein 13-alpha
3	9606.ENSP00000262719	0.983	PH domain leucine-rich repeat-containing protein phosphatase 1
4	9606.ENSP00000296782	0.981	Rapamycin-insensitive companion of mTOR
5	9606.ENSP00000219476	0.980	Tuberin
6	9606.ENSP00000324806	0.979	Glycogen synthase kinase-3 beta
7	9606.ENSP00000354558	0.979	Serine/threonine-protein kinase mTOR
8	9606.ENSP00000366863	0.977	TBC1 domain family member 4
9	9606.ENSP00000307272	0.974	Regulatory-associated protein of mTOR
10	9606.ENSP00000451828	0.974	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000344456	0.972	Catenin beta-1
12	9606.ENSP00000380432	0.972	Insulin
13	9606.ENSP00000344220	0.971	3-phosphoinositide-dependent protein kinase 1
14	9606.ENSP00000375711	0.971	Proline-rich AKT1 substrate 1
15	9606.ENSP00000368880	0.969	Forkhead box protein O1
16	9606.ENSP00000457991	0.969	PH domain leucine-rich repeat-containing protein phosphatase 2
17	9606.ENSP00000298552	0.964	Hamartin
18	9606.ENSP00000351908	0.961	Mitogen-activated protein kinase kinase kinase 5
19	9606.ENSP00000269305	0.960	Cellular tumor antigen p53
20	9606.ENSP00000363377	0.953	Forkhead box protein O4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0043167	0.792	ion binding
GO:1901363	0.769	heterocyclic compound binding
GO:0043168	0.661	anion binding
GO:0097159	0.626	organic cyclic compound binding
GO:0035639	0.413	purine ribonucleoside triphosphate binding
GO:0017076	0.404	purine nucleotide binding
GO:0032555	0.389	purine ribonucleotide binding
GO:0005524	0.365	ATP binding
GO:0019899	0.337	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0048518	0.983	positive regulation of biological process
GO:0050896	0.982	response to stimulus
GO:0051716	0.922	cellular response to stimulus
GO:0008152	0.880	metabolic process
GO:0019222	0.878	regulation of metabolic process
GO:0060255	0.866	regulation of macromolecule metabolic process
GO:0048522	0.863	positive regulation of cellular process
GO:0031323	0.862	regulation of cellular metabolic process
GO:0071704	0.831	organic substance metabolic process
GO:0044238	0.785	primary metabolic process
GO:0080090	0.776	regulation of primary metabolic process
GO:0023052	0.773	signaling
GO:0007165	0.754	signal transduction
GO:0009893	0.732	positive regulation of metabolic process
GO:0044237	0.731	cellular metabolic process
GO:0006807	0.708	nitrogen compound metabolic process
GO:0043170	0.707	macromolecule metabolic process
GO:0051171	0.703	regulation of nitrogen compound metabolic process
GO:0048519	0.702	negative regulation of biological process
GO:0019538	0.700	protein metabolic process
GO:0048523	0.680	negative regulation of cellular process
GO:0036211	0.634	protein modification process
GO:0006796	0.598	phosphate-containing compound metabolic process
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0042221	0.518	response to chemical
GO:0070887	0.514	cellular response to chemical stimulus
GO:0048583	0.488	regulation of response to stimulus
GO:0016310	0.474	phosphorylation
GO:0031325	0.472	positive regulation of cellular metabolic process
GO:0010033	0.461	response to organic substance
GO:0051173	0.443	positive regulation of nitrogen compound metabolic process
GO:0009889	0.437	regulation of biosynthetic process
GO:0023051	0.436	regulation of signaling
GO:0031326	0.434	regulation of cellular biosynthetic process
GO:0010556	0.428	regulation of macromolecule biosynthetic process
GO:0065009	0.394	regulation of molecular function
GO:0051246	0.390	regulation of protein metabolic process
GO:0050793	0.389	regulation of developmental process
GO:0010646	0.386	regulation of cell communication
GO:0032879	0.373	regulation of localization
GO:0048856	0.359	anatomical structure development
GO:0006468	0.355	protein phosphorylation
GO:0051049	0.352	regulation of transport
GO:0009966	0.347	regulation of signal transduction
GO:0032501	0.345	multicellular organismal process
GO:0051239	0.333	regulation of multicellular organismal process
GO:0010468	0.332	regulation of gene expression
GO:1901653	0.317	cellular response to peptide
GO:0007166	0.310	cell surface receptor signaling pathway
GO:0010941	0.308	regulation of cell death
GO:0071375	0.308	cellular response to peptide hormone stimulus
GO:0009892	0.304	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.998	membrane
GO:0005654	0.997	nucleoplasm
GO:0005829	0.988	cytosol
GO:0005886	0.976	plasma membrane
GO:0032991	0.556	protein-containing complex
GO:0043228	0.317	non-membrane-bounded organelle
GO:0043232	0.313	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]