StarFunc result for job id P31785

User Input

>input (369 residues)
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31785	1.000	1.000	1.684E-66	369	1.000	1.000	P31785.pdb.gz	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
2	AFDB:P34902	0.619	0.619	1.226E-48	369	0.675	0.675	P34902.pdb.gz	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
3	AFDB:A8WH93	0.485	0.493	1.303E-23	362	0.255	0.260	A8WH93.pdb.gz	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
4	AFDB:A0A0R4IRZ4	0.434	0.329	7.779E-19	509	0.173	0.126	A0A0R4IRZ4.pdb.gz
5	AFDB:Q8R4S8	0.465	0.476	1.208E-18	360	0.184	0.189	Q8R4S8.pdb.gz	CRLF2_RAT Cytokine receptor-like factor 2 OS=Rattus norvegicus OX=10116 GN=Crlf2 PE=1 SV=1
6	AFDB:Q9HC73	0.452	0.450	1.208E-18	371	0.187	0.186	Q9HC73.pdb.gz	CRLF2_HUMAN Cytokine receptor-like factor 2 OS=Homo sapiens OX=9606 GN=CRLF2 PE=1 SV=1
7	AFDB:Q5MKL1	0.439	0.283	7.833E-18	594	0.154	0.096	Q5MKL1.pdb.gz	Q5MKL1_ONCMY Growth hormone receptor OS=Oncorhynchus mykiss OX=8022 GN=GHR2b PE=2 SV=1
8	AFDB:Q5J7P6	0.433	0.287	1.787E-17	594	0.198	0.123	Q5J7P6.pdb.gz	Q5J7P6_SALSA Growth hormone receptor isoform 1 OS=Salmo salar OX=8030 GN=GHR1 PE=2 SV=1
9	AFDB:Q8CII9	0.447	0.458	1.888E-17	359	0.182	0.187	Q8CII9.pdb.gz	CRLF2_MOUSE Cytokine receptor-like factor 2 OS=Mus musculus OX=10090 GN=Crlf2 PE=1 SV=2
10	AFDB:F1MQ39	0.414	0.253	2.107E-17	634	0.163	0.095	F1MQ39.pdb.gz	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
11	PDB:7u7nC	0.398	0.676	2.148E-13	200	0.100	0.185	7u7nC.pdb.gz
12	PDB:7z0lB	0.410	0.409	1.412E-10	370	0.095	0.095	7z0lB.pdb.gz
13	PDB:5mj3A	0.328	0.391	4.271E-9	302	0.079	0.096	5mj3A.pdb.gz
14	PDB:3besR	0.323	0.439	4.070E-8	250	0.049	0.072	3besR.pdb.gz
15	PDB:6pxvA	0.260	0.134	2.966E-6	823	0.060	0.027	6pxvA.pdb.gz
16	PDB:8eyyA	0.261	0.141	3.134E-6	775	0.062	0.030	8eyyA.pdb.gz
17	PDB:8dtlA	0.253	0.143	4.126E-6	741	0.060	0.030	8dtlA.pdb.gz
18	PDB:6pyhD	0.245	0.130	6.768E-6	798	0.084	0.039	6pyhD.pdb.gz
19	PDB:7bwaA	0.219	0.136	1.051E-5	674	0.065	0.036	7bwaA.pdb.gz
20	PDB:6kzbC	0.181	0.129	2.397E-5	649	0.076	0.043	6kzbC.pdb.gz	Competitive Binding of Magnesium to Calcium Binding Sites Reciprocally Regulates Transamidase and GTP Hydrolysis Activity of Transglutaminase 2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31785	0.0	764	369	1.000	1.000	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
2	P34902	2.73e-175	493	369	0.678	0.678	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
3	A8WH93	1.92e-29	118	362	0.252	0.257	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
4	Q14627	1.66e-16	82.4	380	0.163	0.158	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
5	P78552	3.36e-10	63.5	427	0.176	0.152	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
6	Q8VHK6	1.78e-09	61.2	385	0.122	0.117	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
7	Q561K3	2.74e-09	60.5	426	0.173	0.150	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
8	P32927	2.98e-09	61.2	897	0.163	0.067	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
9	A0A8I6A7D4	3.48e-09	60.1	390	0.173	0.164	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
10	O88786	4.50e-09	59.7	383	0.122	0.117	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
11	P15509	2.04e-07	54.7	400	0.160	0.147	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
12	Q2VBQ8	4.30e-07	53.9	509	0.176	0.128	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
13	Q9HC73	7.21e-07	53.1	371	0.136	0.135	CRLF2_HUMAN Cytokine receptor-like factor 2 OS=Homo sapiens OX=9606 GN=CRLF2 PE=1 SV=1
14	E6ZCC8	3.38e-06	50.8	387	0.187	0.178	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
15	P21183	5.32e-06	50.4	415	0.130	0.116	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
16	Q01344	5.92e-06	50.1	420	0.154	0.136	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
17	Q99PS3	7.44e-06	50.1	414	0.127	0.114	Q99PS3_RAT Interleukin-5 receptor alpha chain OS=Rattus norvegicus OX=10116 GN=Il5ra PE=2 SV=1
18	G3V6S7	7.77e-06	50.1	448	0.127	0.105	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
19	Q4W815	2.22e-05	48.5	525	0.168	0.118	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1
20	Q04594	3.26e-05	48.1	831	0.119	0.053	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	0.0096	27.5	Erythropoietin receptor, ligand binding
2	PF00041 fn3	0.014	27.0	Fibronectin type III domain
3	PF09240 IL6Ra-bind	4.6e-07	41.5	Interleukin-6 receptor alpha chain, binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216223	0.999	Interleukin-2 receptor subunit beta
2	9606.ENSP00000226730	0.999	Interleukin-2
3	9606.ENSP00000231449	0.999	Interleukin-4
4	9606.ENSP00000379111	0.999	Interleukin-4 receptor subunit alpha
5	9606.ENSP00000391676	0.999	Tyrosine-protein kinase JAK3
6	9606.ENSP00000306157	0.998	Interleukin-7 receptor subunit alpha
7	9606.ENSP00000369293	0.998	Interleukin-2 receptor subunit alpha
8	9606.ENSP00000296545	0.995	Interleukin-15
9	9606.ENSP00000343204	0.995	Tyrosine-protein kinase JAK1
10	9606.ENSP00000263851	0.991	Interleukin-7
11	9606.ENSP00000380421	0.986	Interleukin 15 receptor subunit alpha
12	9606.ENSP00000341208	0.976	Signal transducer and activator of transcription 5A
13	9606.ENSP00000386559	0.973	T-cell surface glycoprotein CD8 alpha chain
14	9606.ENSP00000293328	0.971	Signal transducer and activator of transcription 5B
15	9606.ENSP00000338010	0.963	Interleukin-21 receptor
16	9606.ENSP00000300692	0.962	T-cell surface glycoprotein CD3 delta chain
17	9606.ENSP00000354566	0.958	T-cell surface glycoprotein CD3 epsilon chain
18	9606.ENSP00000300134	0.955	Signal transducer and activator of transcription 6
19	9606.ENSP00000354394	0.953	Signal transducer and activator of transcription 1-alpha/beta
20	9606.ENSP00000337825	0.949	Tyrosine-protein kinase Lck

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.999	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0048518	0.990	positive regulation of biological process
GO:0002376	0.957	immune system process
GO:0007165	0.952	signal transduction
GO:0032879	0.934	regulation of localization
GO:0007166	0.931	cell surface receptor signaling pathway
GO:0042221	0.919	response to chemical
GO:0010033	0.901	response to organic substance
GO:0048522	0.873	positive regulation of cellular process
GO:0071310	0.867	cellular response to organic substance
GO:0051049	0.838	regulation of transport
GO:0034097	0.829	response to cytokine
GO:0060627	0.736	regulation of vesicle-mediated transport
GO:0006955	0.697	immune response
GO:0071345	0.693	cellular response to cytokine stimulus
GO:0050764	0.663	regulation of phagocytosis
GO:0019222	0.647	regulation of metabolic process
GO:0060255	0.578	regulation of macromolecule metabolic process
GO:0032501	0.476	multicellular organismal process
GO:0019221	0.448	cytokine-mediated signaling pathway
GO:0051050	0.445	positive regulation of transport
GO:0051239	0.402	regulation of multicellular organismal process
GO:0002682	0.387	regulation of immune system process
GO:0010468	0.382	regulation of gene expression
GO:0009893	0.381	positive regulation of metabolic process
GO:0002684	0.370	positive regulation of immune system process
GO:0032502	0.369	developmental process
GO:0010604	0.358	positive regulation of macromolecule metabolic process
GO:0051240	0.337	positive regulation of multicellular organismal process
GO:0048856	0.319	anatomical structure development
GO:0050865	0.319	regulation of cell activation
GO:0050766	0.313	positive regulation of phagocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.991	endomembrane system
GO:0009986	0.988	cell surface
GO:0005622	0.981	intracellular anatomical structure
GO:0043227	0.966	membrane-bounded organelle
GO:0005737	0.921	cytoplasm
GO:0043231	0.902	intracellular membrane-bounded organelle
GO:0031982	0.814	vesicle
GO:0097708	0.755	intracellular vesicle
GO:0031410	0.699	cytoplasmic vesicle
GO:0005768	0.570	endosome
GO:0005829	0.486	cytosol
GO:0032991	0.371	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]