StarFunc result for job id P31930

User Input

>input (480 residues)
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31930	1.000	1.000	4.830E-95	480	1.000	1.000	P31930.pdb.gz	QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3
2	AFDB:Q68FY0	0.953	0.953	3.353E-88	480	0.881	0.881	Q68FY0.pdb.gz	QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrc1 PE=1 SV=1
3	PDB:7o37A	0.924	0.995	2.085E-76	446	0.831	0.895	7o37A.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
4	PDB:5xteY	0.919	0.989	1.625E-73	446	0.929	1.000	5xteY.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
5	AFDB:Q03346	0.906	0.890	4.094E-65	489	0.548	0.538	Q03346.pdb.gz	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
6	AFDB:Q9VFF0	0.907	0.926	7.426E-65	470	0.529	0.540	Q9VFF0.pdb.gz	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
7	AFDB:G3V0E4	0.906	0.888	1.024E-62	490	0.521	0.510	G3V0E4.pdb.gz	G3V0E4_HUMAN Peptidase (Mitochondrial processing) beta, isoform CRA_c OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=1
8	AFDB:Q42290	0.902	0.816	4.365E-56	531	0.438	0.395	Q42290.pdb.gz	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
9	AFDB:Q5BFD3	0.903	0.905	6.730E-56	479	0.425	0.426	Q5BFD3.pdb.gz	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1
10	AFDB:Q9P7X1	0.890	0.934	2.338E-55	457	0.433	0.455	Q9P7X1.pdb.gz	MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr1 PE=2 SV=1
11	AFDB:Q4W6B5	0.906	0.926	3.902E-54	469	0.367	0.375	Q4W6B5.pdb.gz	MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum OX=44689 GN=mppB PE=1 SV=1
12	AFDB:P98080	0.913	0.930	1.822E-52	471	0.381	0.389	P98080.pdb.gz	UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ucr-1 PE=3 SV=2
13	PDB:1hr6D	0.865	0.935	7.431E-47	443	0.348	0.377	1hr6D.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
14	PDB:1kb9A	0.821	0.911	4.610E-38	431	0.267	0.297	1kb9A.pdb.gz	SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
15	PDB:1hr6A	0.821	0.861	1.088E-33	457	0.231	0.243	1hr6A.pdb.gz	Crystal structures of mitochondrial processing peptidase reveal the mode for specific cleavage of import signal sequences.
16	PDB:3hdiA	0.795	0.918	2.083E-33	414	0.219	0.254	3hdiA.pdb.gz	Crystal and solution structures of a prokaryotic M16B peptidase: an open and shut case.
17	PDB:7o37B	0.810	0.920	2.577E-31	420	0.185	0.212	7o37B.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
18	PDB:5xteK	0.779	0.888	5.639E-30	419	0.192	0.220	5xteK.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
19	PDB:6ofsA	0.693	0.387	1.041E-24	905	0.148	0.078	6ofsA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
20	PDB:1q2lA	0.679	0.372	4.344E-21	937	0.167	0.085	1q2lA.pdb.gz	Crystal Structure of pitrilysin, the prototype of insulin-degrading enzymes

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V0E4	0.0	536	490	0.510	0.500	G3V0E4_HUMAN Peptidase (Mitochondrial processing) beta, isoform CRA_c OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=1
2	O75439	0.0	566	489	0.537	0.528	MPPB_HUMAN Mitochondrial-processing peptidase subunit beta OS=Homo sapiens OX=9606 GN=PMPCB PE=1 SV=2
3	P31930	0.0	999	480	1.000	1.000	QCR1_HUMAN Cytochrome b-c1 complex subunit 1, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC1 PE=1 SV=3
4	Q03346	0.0	559	489	0.560	0.550	MPPB_RAT Mitochondrial-processing peptidase subunit beta OS=Rattus norvegicus OX=10116 GN=Pmpcb PE=1 SV=3
5	Q68FY0	0.0	890	480	0.881	0.881	QCR1_RAT Cytochrome b-c1 complex subunit 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Uqcrc1 PE=1 SV=1
6	Q9CXT8	0.0	561	489	0.542	0.532	MPPB_MOUSE Mitochondrial-processing peptidase subunit beta OS=Mus musculus OX=10090 GN=Pmpcb PE=1 SV=1
7	Q9CZ13	0.0	895	480	0.887	0.887	QCR1_MOUSE Cytochrome b-c1 complex subunit 1, mitochondrial OS=Mus musculus OX=10090 GN=Uqcrc1 PE=1 SV=2
8	Q9VFF0	0.0	558	470	0.537	0.549	Q9VFF0_DROME GH01077p OS=Drosophila melanogaster OX=7227 GN=UQCR-C1 PE=1 SV=2
9	Q42290	2.37e-147	433	531	0.423	0.382	MPPB_ARATH Probable mitochondrial-processing peptidase subunit beta, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPbeta PE=1 SV=2
10	Q5BFD3	2.52e-139	411	479	0.442	0.443	Q5BFD3_EMENI Mitochondrial-processing peptidase subunit beta, mitochondrial [Precursor] (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00747 PE=3 SV=1
11	Q9P7X1	5.69e-130	386	457	0.446	0.468	MPPB_SCHPO Probable mitochondrial-processing peptidase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=qcr1 PE=2 SV=1
12	Q4W6B5	5.13e-124	371	469	0.371	0.380	MPPB_DICDI Mitochondrial-processing peptidase subunit beta OS=Dictyostelium discoideum OX=44689 GN=mppB PE=1 SV=1
13	Q23295	3.98e-122	366	458	0.394	0.413	MPPB_CAEEL Mitochondrial-processing peptidase subunit beta OS=Caenorhabditis elegans OX=6239 GN=mppb-1 PE=1 SV=2
14	P98080	2.51e-110	336	471	0.373	0.380	UCR1_CAEEL Cytochrome b-c1 complex subunit 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ucr-1 PE=3 SV=2
15	P10507	2.98e-105	323	462	0.342	0.355	MPPB_YEAST Mitochondrial-processing peptidase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MAS1 PE=1 SV=1
16	A0A1D8PCY8	3.40e-104	320	467	0.356	0.366	A0A1D8PCY8_CANAL Mas1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MAS1 PE=3 SV=1
17	Q38F91	2.81e-62	212	477	0.300	0.302	Q38F91_TRYB2 Mitochondrial processing peptide beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3110 PE=3 SV=1
18	P07256	9.35e-53	186	457	0.287	0.302	QCR1_YEAST Cytochrome b-c1 complex subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COR1 PE=1 SV=1
19	Q57W51	3.60e-51	182	489	0.283	0.278	Q57W51_TRYB2 Mitochondrial processing peptidase, beta subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.230 PE=4 SV=1
20	Q9ZU25	3.51e-45	167	503	0.252	0.241	MPPA1_ARATH Probable mitochondrial-processing peptidase subunit alpha-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MPPalpha1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00675 Peptidase_M16	1.6e-47	172.7	Insulinase (Peptidase family M16)
2	PF05193 Peptidase_M16_C	1.6e-28	111.5	Peptidase M16 inactive domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000203407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268379	0.999	Cytochrome b-c1 complex subunit 2, mitochondrial
2	9606.ENSP00000306397	0.999	Cytochrome b-c1 complex subunit Rieske, mitochondrial
3	9606.ENSP00000309565	0.999	Cytochrome b-c1 complex subunit 6, mitochondrial
4	9606.ENSP00000317159	0.999	Cytochrome c1, heme protein, mitochondrial
5	9606.ENSP00000332887	0.999	Cytochrome b-c1 complex subunit 9
6	9606.ENSP00000362060	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
7	9606.ENSP00000367939	0.999	Cytochrome b-c1 complex subunit 8
8	9606.ENSP00000430494	0.999	Cytochrome b-c1 complex subunit 7
9	9606.ENSP00000467262	0.998	Cytochrome b-c1 complex subunit 10
10	9606.ENSP00000317780	0.997	Cytochrome c oxidase subunit 5A, mitochondrial
11	9606.ENSP00000322450	0.997	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
12	9606.ENSP00000233627	0.995	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
13	9606.ENSP00000266544	0.995	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
14	9606.ENSP00000276689	0.995	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
15	9606.ENSP00000356972	0.994	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
16	9606.ENSP00000330737	0.993	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
17	9606.ENSP00000392709	0.993	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
18	9606.ENSP00000215375	0.992	ATP synthase subunit delta, mitochondrial
19	9606.ENSP00000315774	0.992	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
20	9606.ENSP00000354554	0.992	Cytochrome b

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.993	catalytic activity
GO:0016491	0.740	oxidoreductase activity
GO:0016787	0.669	hydrolase activity
GO:0022857	0.658	transmembrane transporter activity
GO:0140096	0.650	catalytic activity, acting on a protein
GO:0008233	0.602	peptidase activity
GO:0004175	0.506	endopeptidase activity
GO:0009055	0.505	electron transfer activity
GO:0015453	0.498	oxidoreduction-driven active transmembrane transporter activity
GO:0008237	0.488	metallopeptidase activity
GO:0004222	0.462	metalloendopeptidase activity
GO:0008121	0.376	ubiquinol-cytochrome-c reductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008152	0.996	metabolic process
GO:0009987	0.994	cellular process
GO:0044237	0.983	cellular metabolic process
GO:0009060	0.917	aerobic respiration
GO:0006119	0.703	oxidative phosphorylation
GO:0071704	0.329	organic substance metabolic process
GO:0044238	0.305	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	1.000	mitochondrial inner membrane
GO:1902494	0.999	catalytic complex
GO:0070469	0.998	respirasome
GO:0098798	0.991	mitochondrial protein-containing complex
GO:0098803	0.986	respiratory chain complex
GO:1990204	0.982	oxidoreductase complex
GO:0070069	0.960	cytochrome complex
GO:1902495	0.958	transmembrane transporter complex
GO:0005746	0.953	mitochondrial respirasome
GO:0098800	0.952	inner mitochondrial membrane protein complex
GO:0005750	0.852	mitochondrial respiratory chain complex III
GO:0043233	0.708	organelle lumen
GO:0070013	0.657	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.740	Oxidoreductases.
EC:3.-.-.-	0.669	Hydrolases.
EC:3.4.-.-	0.602	Acting on peptide bonds (peptidases).
EC:7.-.-.-	0.498	Translocases.
EC:3.4.24.-	0.462	Metalloendopeptidases.
RHEA:11484	0.376	a quinol + 2 Fe(III)-[cytochrome c](out) = a quinone + 2 Fe(II)-[cytochrome c](out) + 2 H(+)(out)
EC:7.1.1.8	0.376	quinol--cytochrome-c reductase.

[back to server]