StarFunc result for job id P31937

User Input

>input (336 residues)
MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMK
HGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGIL
KKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVED
EFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLL
AKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPI
LLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31937	1.000	1.000	2.229E-66	336	1.000	1.000	P31937.pdb.gz	3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2
2	AFDB:Q9SUC0	0.866	0.839	1.978E-40	347	0.440	0.427	Q9SUC0.pdb.gz	3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g20930 PE=1 SV=3
3	AFDB:Q9V8M5	0.839	0.869	5.257E-40	324	0.449	0.466	Q9V8M5.pdb.gz	3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG15093 PE=2 SV=2
4	AFDB:Q9I5I6	0.868	0.977	1.854E-37	298	0.381	0.430	Q9I5I6.pdb.gz	SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0743 PE=1 SV=1
5	PDB:3obbA	0.844	0.959	2.515E-34	295	0.378	0.431	3obbA.pdb.gz	Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
6	AFDB:Q0QLF5	0.817	0.909	5.463E-32	301	0.295	0.329	Q0QLF5.pdb.gz	HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri OX=1528 GN=Hgd PE=1 SV=1
7	AFDB:Q585Q3	0.816	0.912	3.067E-31	300	0.271	0.303	Q585Q3.pdb.gz	Q585Q3_TRYB2 2-hydroxy-3-oxopropionate reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.310 PE=4 SV=1
8	AFDB:F4I907	0.820	0.771	1.087E-30	358	0.280	0.263	F4I907.pdb.gz	GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=1 SV=1
9	AFDB:P0ABQ2	0.809	0.922	1.534E-30	294	0.298	0.340	P0ABQ2.pdb.gz	GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=garR PE=1 SV=1
10	PDB:3ckyA	0.775	0.870	2.960E-30	297	0.292	0.330	3ckyA.pdb.gz
11	AFDB:Q9SZE1	0.817	0.821	2.568E-29	334	0.265	0.266	Q9SZE1.pdb.gz	3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g29120 PE=1 SV=1
12	AFDB:A0A1D8PQ07	0.787	0.748	5.109E-28	354	0.333	0.316	A0A1D8PQ07.pdb.gz	A0A1D8PQ07_CANAL Hpd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HPD1 PE=4 SV=1
13	PDB:3dojA	0.810	0.926	1.171E-27	292	0.226	0.260	3dojA.pdb.gz
14	PDB:6smzC	0.599	0.679	2.755E-24	295	0.259	0.295	6smzC.pdb.gz	Dynamic Structural Changes Accompany the Production of Dihydroxypropanesulfonate by Sulfolactaldehyde Reductase
15	PDB:2p4qA	0.629	0.461	2.843E-13	476	0.179	0.126	2p4qA.pdb.gz	Crystal structure of Saccharomyces cerevisiae 6-phosphogluconate dehydrogenase Gnd1
16	PDB:1pgjA	0.610	0.445	5.667E-13	478	0.176	0.123	1pgjA.pdb.gz
17	PDB:3fwnA	0.621	0.463	1.343E-12	467	0.176	0.126	3fwnA.pdb.gz	Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
18	PDB:2jkvA	0.522	0.377	2.829E-11	482	0.140	0.098	2jkvA.pdb.gz	Structure of Human Phosphogluconate Dehydrogenase in Complex with Nadph at 2.53A
19	PDB:3khuB	0.598	0.446	7.519E-11	467	0.131	0.094	3khuB.pdb.gz	Structural and Kinetic Evidence That Catalytic Reaction of Human UDP-glucose 6-Dehydrogenase Involves Covalent Thiohemiacetal and Thioester Enzyme Intermediates.
20	PDB:4ypoA	0.497	0.511	1.887E-10	325	0.146	0.151	4ypoA.pdb.gz	Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31937	0.0	687	336	1.000	1.000	3HIDH_HUMAN 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2
2	Q99L13	0.0	626	335	0.911	0.913	3HIDH_MOUSE 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Hibadh PE=1 SV=1
3	Q9V8M5	4.99e-99	297	324	0.458	0.475	3HIDH_DROME Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=CG15093 PE=2 SV=2
4	Q9SUC0	1.98e-94	286	347	0.438	0.424	3HIDH_ARATH Probable 3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g20930 PE=1 SV=3
5	Q9I5I6	9.60e-65	208	298	0.381	0.430	SERDH_PSEAE NAD-dependent L-serine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA0743 PE=1 SV=1
6	P0ABQ2	1.99e-49	169	294	0.301	0.344	GARR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=garR PE=1 SV=1
7	Q0QLF5	7.69e-49	167	301	0.295	0.329	HMGD_EUBBA 2-(hydroxymethyl)glutarate dehydrogenase OS=Eubacterium barkeri OX=1528 GN=Hgd PE=1 SV=1
8	Q585Q3	6.05e-46	160	300	0.280	0.313	Q585Q3_TRYB2 2-hydroxy-3-oxopropionate reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.310 PE=4 SV=1
9	A0A1D8PQ07	5.13e-42	151	354	0.327	0.311	A0A1D8PQ07_CANAL Hpd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HPD1 PE=4 SV=1
10	F4IAP5	3.12e-39	150	1393	0.271	0.065	F4IAP5_ARATH Ketose-bisphosphate aldolase class-II family protein OS=Arabidopsis thaliana OX=3702 GN=At1g18270 PE=1 SV=1
11	P77161	8.51e-39	141	292	0.286	0.329	GLXR_ECOLI 2-hydroxy-3-oxopropionate reductase OS=Escherichia coli (strain K12) OX=83333 GN=glxR PE=2 SV=1
12	F4I907	5.71e-38	140	358	0.271	0.254	GLYR2_ARATH Glyoxylate/succinic semialdehyde reductase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLYR2 PE=1 SV=1
13	P0A9V8	5.80e-37	136	298	0.274	0.309	SQUU_ECOLI 3-sulfolactaldehyde reductase OS=Escherichia coli (strain K12) OX=83333 GN=yihU PE=1 SV=1
14	Q9SZE1	1.18e-28	115	334	0.244	0.246	3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g29120 PE=1 SV=1
15	Q9LSV0	2.38e-26	107	289	0.247	0.287	GLYR1_ARATH Glyoxylate/succinic semialdehyde reductase 1 OS=Arabidopsis thaliana OX=3702 GN=GLYR1 PE=1 SV=1
16	Q8T079	7.80e-25	107	602	0.217	0.121	GLYR1_DROME Cytokine-like nuclear factor N-PAC OS=Drosophila melanogaster OX=7227 GN=Ndf PE=1 SV=1
17	Q49A26	4.71e-23	102	553	0.220	0.134	GLYR1_HUMAN Cytokine-like nuclear factor N-PAC OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=4
18	K7EMM8	7.40e-23	101	524	0.220	0.141	K7EMM8_HUMAN Cytokine-like nuclear factor N-PAC (Fragment) OS=Homo sapiens OX=9606 GN=GLYR1 PE=1 SV=2
19	Q922P9	2.42e-20	94.0	546	0.214	0.132	GLYR1_MOUSE Cytokine-like nuclear factor N-PAC OS=Mus musculus OX=10090 GN=Glyr1 PE=1 SV=1
20	Q57WY0	6.90e-18	85.9	370	0.199	0.181	Q57WY0_TRYB2 Dehydrogenase-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27F10.410 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02826 2-Hacid_dh_C	0.00032	31.6	D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
2	PF02737 3HCDH_N	5	18.5	3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
3	PF03807 F420_oxidored	0.012	27.6	NADP oxidoreductase coenzyme F420-dependent
4	PF07991 IlvN	11	17.1	Acetohydroxy acid isomeroreductase, NADPH-binding domain
5	PF14833 NAD_binding_11	3.1e-31	119.5	NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
6	PF03446 NAD_binding_2	4.6e-44	161.9	NAD binding domain of 6-phosphogluconate dehydrogenase
7	PF02254 TrkA_N	1.2e+02	14.3	TrkA-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018248

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000008092	0.999	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial
2	61853.ENSNLEP00000019640	0.999	Aldehyde dehydrogenase 6 family, member A1
3	61853.ENSNLEP00000024227	0.995	4-aminobutyrate aminotransferase
4	61853.ENSNLEP00000000024	0.973	Aldehyde dehydrogenase 2 family (mitochondrial)
5	61853.ENSNLEP00000022268	0.972	Aldehyde dehydrogenase 1 family, member B1
6	61853.ENSNLEP00000017602	0.961	Alanine--glyoxylate aminotransferase 2
7	61853.ENSNLEP00000017907	0.960	Aldehyde dehydrogenase 9 family, member A1
8	61853.ENSNLEP00000014862	0.950	Aldehyde dehydrogenase 7 family, member A1
9	61853.ENSNLEP00000015739	0.947	hydroxyacyl-CoA dehydrogenase
10	61853.ENSNLEP00000013058	0.940	Aldehyde dehydrogenase 3 family, member A2
11	61853.ENSNLEP00000017191	0.922	Ethylmalonyl-CoA decarboxylase 1
12	61853.ENSNLEP00000014350	0.916	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
13	61853.ENSNLEP00000008441	0.905	Aldehyde oxidase 1
14	61853.ENSNLEP00000007846	0.904	enoyl-CoA, hydratase/3-hydroxyacyl CoA dehydrogenase
15	61853.ENSNLEP00000004840	0.891	Propionyl CoA carboxylase, beta polypeptide
16	61853.ENSNLEP00000019299	0.863	acyl-CoA dehydrogenase, C-2 to C-3 short chain
17	61853.ENSNLEP00000002356	0.862	Belongs to the acyl-CoA oxidase family.
18	61853.ENSNLEP00000005909	0.856	Triosephosphate isomerase 1
19	61853.ENSNLEP00000015929	0.856	Uncharacterized protein
20	61853.ENSNLEP00000005444	0.844	methylcrotonoyl-CoA carboxylase 2 (beta)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.997	protein binding
GO:1901363	0.506	heterocyclic compound binding
GO:0097159	0.506	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0044238	0.994	primary metabolic process
GO:0019752	0.983	carboxylic acid metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0009081	0.973	branched-chain amino acid metabolic process
GO:0046395	0.950	carboxylic acid catabolic process
GO:0009063	0.905	amino acid catabolic process
GO:1901606	0.895	alpha-amino acid catabolic process
GO:0009083	0.845	branched-chain amino acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.944	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.

[back to server]