StarFunc result for job id P31939

User Input

>input (592 residues)
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFT
HTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINL
CDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPIS
AAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIV
ATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKT
GVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDA
FFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1p4rA	0.989	0.994	0.000	589	0.995	1.000	1p4rA.pdb.gz	Crystal structures of human bifunctional enzyme aminoimidazole-4-carboxamide ribonucleotide transformylase/IMP cyclohydrolase in complex with potent sulfonyl-containing antifolates
2	PDB:2b1gA	0.989	0.992	0.000	590	0.833	0.836	2b1gA.pdb.gz	Structure-based Design, Synthesis, Evaluation, and Crystal Structures of Transition State Analogue Inhibitors of Inosine Monophosphate Cyclohydrolase.
3	AFDB:O35567	0.997	0.997	0.000	592	0.912	0.912	O35567.pdb.gz	PUR9_RAT Bifunctional purine biosynthesis protein ATIC OS=Rattus norvegicus OX=10116 GN=Atic PE=1 SV=2
4	AFDB:P31335	0.992	0.990	0.000	593	0.836	0.835	P31335.pdb.gz	PUR9_CHICK Bifunctional purine biosynthesis protein ATIC OS=Gallus gallus OX=9031 GN=ATIC PE=1 SV=1
5	AFDB:Q9VC18	0.990	0.993	2.160E-99	590	0.706	0.708	Q9VC18.pdb.gz	Q9VC18_DROME Bifunctional purine biosynthesis protein ATIC OS=Drosophila melanogaster OX=7227 GN=BEST:GH11240 PE=1 SV=1
6	AFDB:O74928	0.978	0.990	3.155E-92	585	0.601	0.609	O74928.pdb.gz	PUR9_SCHPO Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade10 PE=2 SV=1
7	AFDB:P38009	0.987	0.987	8.490E-92	592	0.617	0.617	P38009.pdb.gz	PUR92_YEAST Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE17 PE=1 SV=2
8	AFDB:P54113	0.982	0.983	1.181E-91	591	0.606	0.607	P54113.pdb.gz	PUR91_YEAST Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE16 PE=1 SV=1
9	AFDB:Q6FY79	0.983	0.986	3.357E-91	590	0.603	0.605	Q6FY79.pdb.gz	Q6FY79_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A03366g PE=3 SV=1
10	AFDB:J9VJP1	0.981	0.960	2.431E-90	605	0.627	0.613	J9VJP1.pdb.gz	PUR9_CRYNH Bifunctional purine biosynthesis protein ADE16 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ADE16 PE=1 SV=1
11	AFDB:Q86L14	0.502	0.546	1.205E-49	542	0.336	0.367	Q86L14.pdb.gz	PUR9_DICDI Bifunctional purine biosynthesis protein purH OS=Dictyostelium discoideum OX=44689 GN=purH PE=1 SV=1
12	AFDB:P15639	0.505	0.561	2.206E-49	529	0.372	0.416	P15639.pdb.gz	PUR9_ECOLI Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) OX=83333 GN=purH PE=1 SV=1
13	PDB:3zzmA	0.488	0.550	1.220E-46	520	0.316	0.360	3zzmA.pdb.gz	Structural Analyses of a Purine Biosynthetic Enzyme from Mycobacterium Tuberculosis Reveal a Novel Bound Nucleotide.
14	PDB:1bxrA	0.163	0.096	5.201E-4	1073	0.044	0.024	1bxrA.pdb.gz	Carbamoyl phosphate synthetase: closure of the B-domain as a result of nucleotide binding.
15	PDB:4ggmX	0.159	0.318	5.534E-3	277	0.084	0.181	4ggmX.pdb.gz	LpxI structures reveal how a lipid A precursor is synthesized.
16	PDB:5douD	0.154	0.071	6.527E-3	1430	0.037	0.015	5douD.pdb.gz	Structure of human carbamoyl phosphate synthetase: deciphering the on/off switch of human ureagenesis.
17	PDB:1gvfB	0.092	0.166	4.473E-2	275	0.041	0.087	1gvfB.pdb.gz	Structure of Tagatose-1,6-Bisphosphate Aldolase; Insight Into Chiral Discrimination, Mechanism and Specificity of Class II Aldolases
18	PDB:3l9wB	0.124	0.187	5.275E-2	357	0.035	0.059	3l9wB.pdb.gz	Mechanism of ligand-gated potassium efflux in bacterial pathogens.
19	PDB:3g8qA	0.124	0.244	6.944E-2	278	0.046	0.097	3g8qA.pdb.gz	A cytidine deaminase edits C to U in transfer RNAs in Archaea
20	PDB:8aw33	0.150	0.285	6.944E-2	279	0.041	0.086	8aw33.pdb.gz	Structural basis for sequence-independent substrate selection by eukaryotic wobble base tRNA deaminase ADAT2/3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J9VJP1	0.0	755	605	0.630	0.617	PUR9_CRYNH Bifunctional purine biosynthesis protein ADE16 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=ADE16 PE=1 SV=1
2	O35567	0.0	1132	592	0.912	0.912	PUR9_RAT Bifunctional purine biosynthesis protein ATIC OS=Rattus norvegicus OX=10116 GN=Atic PE=1 SV=2
3	O74928	0.0	723	585	0.601	0.609	PUR9_SCHPO Bifunctional purine biosynthesis protein ade10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade10 PE=2 SV=1
4	P31335	0.0	1059	593	0.833	0.831	PUR9_CHICK Bifunctional purine biosynthesis protein ATIC OS=Gallus gallus OX=9031 GN=ATIC PE=1 SV=1
5	P31939	0.0	1227	592	1.000	1.000	PUR9_HUMAN Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3
6	P38009	0.0	746	592	0.613	0.613	PUR92_YEAST Bifunctional purine biosynthesis protein ADE17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE17 PE=1 SV=2
7	P54113	0.0	741	591	0.608	0.609	PUR91_YEAST Bifunctional purine biosynthesis protein ADE16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE16 PE=1 SV=1
8	Q6FY79	0.0	735	590	0.605	0.607	Q6FY79_CANGA Candida glabrata strain CBS138 chromosome A complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0A03366g PE=3 SV=1
9	Q95RT1	0.0	590	383	0.465	0.718	Q95RT1_DROME LD12501p OS=Drosophila melanogaster OX=7227 GN=CG11089 PE=2 SV=1
10	Q9CWJ9	0.0	1134	592	0.910	0.910	PUR9_MOUSE Bifunctional purine biosynthesis protein ATIC OS=Mus musculus OX=10090 GN=Atic PE=1 SV=2
11	Q9VC18	0.0	878	590	0.706	0.708	Q9VC18_DROME Bifunctional purine biosynthesis protein ATIC OS=Drosophila melanogaster OX=7227 GN=BEST:GH11240 PE=1 SV=1
12	V9HWH7	0.0	1227	592	1.000	1.000	V9HWH7_HUMAN Bifunctional purine biosynthesis protein ATIC OS=Homo sapiens OX=9606 GN=HEL-S-70p PE=2 SV=1
13	P15639	5.40e-90	289	529	0.363	0.406	PUR9_ECOLI Bifunctional purine biosynthesis protein PurH OS=Escherichia coli (strain K12) OX=83333 GN=purH PE=1 SV=1
14	Q86L14	1.42e-77	257	542	0.306	0.334	PUR9_DICDI Bifunctional purine biosynthesis protein purH OS=Dictyostelium discoideum OX=44689 GN=purH PE=1 SV=1
15	Q8RWT5	8.01e-66	227	596	0.285	0.284	Q8RWT5_ARATH AICARFT/IMPCHase bienzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At2g35040 PE=1 SV=1
16	P9WHM7	4.17e-64	221	523	0.277	0.314	PUR9_MYCTU Bifunctional purine biosynthesis protein PurH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purH PE=1 SV=1
17	Q726E7	3.77e-21	99.4	510	0.203	0.235	Q726E7_DESVH Phosphoribosylaminoimidazolecarboxamide formyltransferase, putative OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_3206 PE=1 SV=1
18	P38100	0.13	37.7	1073	0.035	0.020	CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=carB PE=3 SV=3
19	Q86UP0	2.7	33.5	819	0.047	0.034	CAD24_HUMAN Cadherin-24 OS=Homo sapiens OX=9606 GN=CDH24 PE=1 SV=1
20	Q8SWY2	3.3	33.1	1009	0.066	0.039	Q8SWY2_DROME GH01626p OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01808 AICARFT_IMPCHas	2e-96	334.7	AICARFT/IMPCHase bienzyme
2	PF02142 MGS	9.8e-22	88.3	MGS-like domain
3	PF16320 Ribosomal_L12_N	8	17.6	Ribosomal protein L7/L12 dimerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000236959

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371253	0.999	Trifunctional purine biosynthetic protein adenosine-3
2	9606.ENSP00000485525	0.999	Adenylosuccinate lyase
3	9606.ENSP00000318868	0.996	Serine hydroxymethyltransferase, cytosolic
4	9606.ENSP00000382595	0.996	Multifunctional protein ADE2
5	9606.ENSP00000333667	0.995	Serine hydroxymethyltransferase, mitochondrial
6	9606.ENSP00000216605	0.993	C-1-tetrahydrofolate synthase, cytoplasmic
7	9606.ENSP00000367615	0.993	Adenine phosphoribosyltransferase
8	9606.ENSP00000313490	0.988	Phosphoribosylformylglycinamidine synthase
9	9606.ENSP00000355493	0.988	Adenylosuccinate synthetase isozyme 2
10	9606.ENSP00000264220	0.987	Amidophosphoribosyltransferase
11	9606.ENSP00000377617	0.986	Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial
12	9606.ENSP00000333019	0.983	Adenylosuccinate synthetase isozyme 1
13	9606.ENSP00000379108	0.983	Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2
14	9606.ENSP00000396308	0.982	Dihydrofolate reductase
15	9606.ENSP00000273588	0.979	Aminomethyltransferase, mitochondrial
16	9606.ENSP00000476535	0.977	annotation not available
17	9606.ENSP00000478253	0.974	Monofunctional C1-tetrahydrofolate synthase, mitochondrial
18	9606.ENSP00000321584	0.973	Inosine-5'-monophosphate dehydrogenase 2
19	9606.ENSP00000369456	0.970	Inosine triphosphate pyrophosphatase
20	9606.ENSP00000430075	0.970	AMP deaminase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004643	1.000	phosphoribosylaminoimidazolecarboxamide formyltransferase activity
GO:0003937	1.000	IMP cyclohydrolase activity
GO:0042802	0.939	identical protein binding
GO:0046983	0.911	protein dimerization activity
GO:0042803	0.904	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:1901564	0.997	organonitrogen compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0006164	0.994	purine nucleotide biosynthetic process
GO:0046040	0.973	IMP metabolic process
GO:0009168	0.973	purine ribonucleoside monophosphate biosynthetic process
GO:0009152	0.973	purine ribonucleotide biosynthetic process
GO:0046037	0.872	GMP metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.983	membrane
GO:0071944	0.891	cell periphery
GO:0005886	0.882	plasma membrane
GO:0043227	0.847	membrane-bounded organelle
GO:0043229	0.831	intracellular organelle
GO:0043231	0.802	intracellular membrane-bounded organelle
GO:0070013	0.524	intracellular organelle lumen
GO:0065010	0.417	extracellular membrane-bounded organelle
GO:1903561	0.405	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22192	1.000	(6R)-10-formyltetrahydrofolate + 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole-4-carboxamide = (6S)-5,6,7,8-tetrahydrofolate + 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
EC:2.1.2.3	1.000	phosphoribosylaminoimidazolecarboxamide formyltransferase.
RHEA:18445	1.000	H2O + IMP = 5-formamido-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide
EC:3.5.4.10	1.000	IMP cyclohydrolase.

[back to server]