StarFunc result for job id P31947

User Input

>input (248 residues)
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPQEPQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O70456	0.999	0.999	1.680E-30	248	0.976	0.976	O70456.pdb.gz	1433S_MOUSE 14-3-3 protein sigma OS=Mus musculus OX=10090 GN=Sfn PE=1 SV=2
2	PDB:5ok9B	0.894	0.916	2.481E-26	242	0.907	0.930	5ok9B.pdb.gz
3	AFDB:P63101	0.967	0.978	9.534E-24	245	0.698	0.706	P63101.pdb.gz	1433Z_MOUSE 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1
4	AFDB:P31946	0.973	0.981	2.038E-23	246	0.665	0.671	P31946.pdb.gz	1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3
5	AFDB:P61981	0.968	0.971	2.131E-23	247	0.641	0.644	P61981.pdb.gz	1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2
6	AFDB:P27348	0.946	0.958	2.786E-23	245	0.698	0.706	P27348.pdb.gz	1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1
7	AFDB:P29310	0.954	0.954	6.513E-23	248	0.649	0.649	P29310.pdb.gz	1433Z_DROME 14-3-3 protein zeta OS=Drosophila melanogaster OX=7227 GN=14-3-3zeta PE=1 SV=1
8	AFDB:Q5ZKJ2	0.957	0.961	1.392E-22	247	0.629	0.632	Q5ZKJ2.pdb.gz	Q5ZKJ2_CHICK 14-3-3 domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_10g10 PE=2 SV=1
9	AFDB:Q6ZKC0	0.977	0.947	1.820E-22	256	0.581	0.562	Q6ZKC0.pdb.gz	14333_ORYSJ 14-3-3-like protein GF14-C OS=Oryza sativa subsp. japonica OX=39947 GN=GF14C PE=1 SV=1
10	AFDB:P41932	0.941	0.941	4.069E-22	248	0.637	0.637	P41932.pdb.gz	14331_CAEEL 14-3-3-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=par-5 PE=1 SV=2
11	AFDB:Q20655	0.937	0.937	4.255E-22	248	0.637	0.637	Q20655.pdb.gz	14332_CAEEL 14-3-3-like protein 2 OS=Caenorhabditis elegans OX=6239 GN=ftt-2 PE=1 SV=1
12	PDB:6gn0A	0.938	0.972	8.253E-22	239	0.661	0.686	6gn0A.pdb.gz
13	PDB:2btpA	0.888	0.888	1.543E-21	248	0.665	0.665	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
14	PDB:5yqgC	0.916	0.958	1.543E-21	237	0.609	0.637	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
15	PDB:4zdrA	0.904	0.923	3.944E-21	243	0.673	0.687	4zdrA.pdb.gz	Structure of the 14-3-3 zeta-LKB1 fusion protein provides insight into a novel ligand-binding mode of 14-3-3.
16	PDB:2br9A	0.903	0.972	1.723E-20	230	0.573	0.617	2br9A.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
17	PDB:4j6sB	0.918	0.936	1.884E-20	243	0.625	0.638	4j6sB.pdb.gz	The N-terminal sequence of tyrosine hydroxylase is a conformationally versatile motif that binds 14-3-3 proteins and membranes.
18	PDB:3axyC	0.908	0.958	2.253E-20	235	0.569	0.600	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
19	PDB:4f7rD	0.793	0.824	4.385E-16	238	0.500	0.521	4f7rD.pdb.gz
20	PDB:3txmA	0.353	0.277	5.283E-3	353	0.153	0.108	3txmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31947	0.0	509	248	1.000	1.000	1433S_HUMAN 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN PE=1 SV=1
2	O70456	1.57e-180	497	248	0.976	0.976	1433S_MOUSE 14-3-3 protein sigma OS=Mus musculus OX=10090 GN=Sfn PE=1 SV=2
3	P27348	2.76e-123	352	245	0.694	0.702	1433T_HUMAN 14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1
4	P63104	4.61e-123	351	245	0.706	0.714	1433Z_HUMAN 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1
5	P68254	2.07e-122	350	245	0.690	0.698	1433T_MOUSE 14-3-3 protein theta OS=Mus musculus OX=10090 GN=Ywhaq PE=1 SV=1
6	P68255	2.07e-122	350	245	0.690	0.698	1433T_RAT 14-3-3 protein theta OS=Rattus norvegicus OX=10116 GN=Ywhaq PE=1 SV=1
7	P63101	4.65e-122	349	245	0.702	0.710	1433Z_MOUSE 14-3-3 protein zeta/delta OS=Mus musculus OX=10090 GN=Ywhaz PE=1 SV=1
8	P63102	4.65e-122	349	245	0.702	0.710	1433Z_RAT 14-3-3 protein zeta/delta OS=Rattus norvegicus OX=10116 GN=Ywhaz PE=1 SV=1
9	Q5ZKC9	5.98e-122	348	245	0.698	0.706	1433Z_CHICK 14-3-3 protein zeta OS=Gallus gallus OX=9031 GN=YWHAZ PE=2 SV=1
10	Q5PRD0	1.42e-121	347	244	0.673	0.684	143BA_DANRE 14-3-3 protein beta/alpha-A OS=Danio rerio OX=7955 GN=ywhaba PE=2 SV=2
11	P35213	9.61e-119	340	246	0.665	0.671	1433B_RAT 14-3-3 protein beta/alpha OS=Rattus norvegicus OX=10116 GN=Ywhab PE=1 SV=3
12	Q9CQV8	1.90e-118	340	246	0.661	0.667	1433B_MOUSE 14-3-3 protein beta/alpha OS=Mus musculus OX=10090 GN=Ywhab PE=1 SV=3
13	P31946	2.05e-118	340	246	0.661	0.667	1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3
14	V9HWD6	2.05e-118	340	246	0.661	0.667	V9HWD6_HUMAN Epididymis secretory protein Li 1 OS=Homo sapiens OX=9606 GN=HEL-S-1 PE=2 SV=1
15	Q6PC29	1.73e-114	330	247	0.645	0.648	143G1_DANRE 14-3-3 protein gamma-1 OS=Danio rerio OX=7955 GN=ywhag1 PE=2 SV=1
16	P61981	3.41e-114	329	247	0.641	0.644	1433G_HUMAN 14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2
17	P61982	3.41e-114	329	247	0.641	0.644	1433G_MOUSE 14-3-3 protein gamma OS=Mus musculus OX=10090 GN=Ywhag PE=1 SV=2
18	P61983	3.41e-114	329	247	0.641	0.644	1433G_RAT 14-3-3 protein gamma OS=Rattus norvegicus OX=10116 GN=Ywhag PE=1 SV=2
19	P29310	7.12e-114	328	248	0.653	0.653	1433Z_DROME 14-3-3 protein zeta OS=Drosophila melanogaster OX=7227 GN=14-3-3zeta PE=1 SV=1
20	Q5F3W6	1.78e-113	327	247	0.641	0.644	1433G_CHICK 14-3-3 protein gamma OS=Gallus gallus OX=9031 GN=YWHAG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00244 14-3-3	2.5e-98	339.6	14-3-3 protein
2	PF15499 Peptidase_C98	4e+02	11.9	Ubiquitin-specific peptidase-like, SUMO isopeptidase
3	PF05769 SIKE	1.4e+02	13.8	SIKE family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022474

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000011861	0.991	Cellular tumor antigen p53
2	61853.ENSNLEP00000021815	0.970	Leucine-rich repeat kinase 2
3	61853.ENSNLEP00000023993	0.957	Cyclin-dependent kinase 1
4	61853.ENSNLEP00000004906	0.954	Cyclin B1
5	61853.ENSNLEP00000014310	0.948	Aminopeptidase
6	61853.ENSNLEP00000001356	0.947	Forkhead box O1
7	61853.ENSNLEP00000014073	0.941	Cyclin B2
8	61853.ENSNLEP00000005992	0.889	BCL2-associated agonist of cell death
9	61853.ENSNLEP00000010865	0.889	Cell division cycle 25C
10	61853.ENSNLEP00000021326	0.881	Cyclin-dependent kinase 2
11	61853.ENSNLEP00000009939	0.865	Cyclin B3
12	61853.ENSNLEP00000010055	0.862	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
13	61853.ENSNLEP00000010419	0.840	Receptor protein-tyrosine kinase
14	61853.ENSNLEP00000005755	0.828	Raf-1 proto-oncogene, serine/threonine kinase
15	61853.ENSNLEP00000003935	0.824	Uncharacterized protein
16	61853.ENSNLEP00000019838	0.820	V-akt murine thymoma viral oncogene homolog 1
17	61853.ENSNLEP00000013842	0.814	Heat shock protein, alpha-crystallin-related, B6
18	61853.ENSNLEP00000011129	0.807	Tuberous sclerosis 2
19	61853.ENSNLEP00000007786	0.798	Cell division cycle 25A
20	61853.ENSNLEP00000016031	0.787	KIAA0930

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.400	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.933	regulation of metabolic process
GO:0050896	0.858	response to stimulus
GO:0048518	0.772	positive regulation of biological process
GO:0060255	0.764	regulation of macromolecule metabolic process
GO:0051171	0.734	regulation of nitrogen compound metabolic process
GO:0080090	0.687	regulation of primary metabolic process
GO:0031323	0.686	regulation of cellular metabolic process
GO:0048519	0.681	negative regulation of biological process
GO:0051716	0.675	cellular response to stimulus
GO:0048522	0.629	positive regulation of cellular process
GO:0048523	0.582	negative regulation of cellular process
GO:0065009	0.471	regulation of molecular function
GO:0023052	0.459	signaling
GO:0007154	0.459	cell communication
GO:0071840	0.458	cellular component organization or biogenesis
GO:0007165	0.453	signal transduction
GO:0010468	0.434	regulation of gene expression
GO:0006950	0.431	response to stress
GO:0051246	0.416	regulation of protein metabolic process
GO:0016043	0.378	cellular component organization
GO:0032502	0.373	developmental process
GO:0009892	0.355	negative regulation of metabolic process
GO:0042221	0.354	response to chemical
GO:0019219	0.353	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.344	regulation of biosynthetic process
GO:0048856	0.338	anatomical structure development
GO:0008152	0.327	metabolic process
GO:0010604	0.319	positive regulation of macromolecule metabolic process
GO:0051179	0.314	localization
GO:0031326	0.310	regulation of cellular biosynthetic process
GO:0010556	0.309	regulation of macromolecule biosynthetic process
GO:0023051	0.307	regulation of signaling
GO:0071704	0.303	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0043231	0.976	intracellular membrane-bounded organelle
GO:0070013	0.965	intracellular organelle lumen
GO:0005634	0.962	nucleus
GO:0031981	0.951	nuclear lumen
GO:0031982	0.906	vesicle
GO:0065010	0.901	extracellular membrane-bounded organelle
GO:1903561	0.887	extracellular vesicle
GO:0070062	0.834	extracellular exosome
GO:0016020	0.786	membrane
GO:0005654	0.553	nucleoplasm
GO:0071944	0.485	cell periphery
GO:0005886	0.453	plasma membrane
GO:0032991	0.410	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]