StarFunc result for job id P31995

User Input

>input (323 residues)
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P31995	1.000	1.000	6.857E-58	323	1.000	1.000	P31995.pdb.gz	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
2	AFDB:P31994	0.706	0.735	1.436E-48	310	0.817	0.852	P31994.pdb.gz	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
3	AFDB:P12318	0.702	0.714	3.432E-45	317	0.836	0.852	P12318.pdb.gz	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
4	AFDB:P08101	0.586	0.574	1.969E-34	330	0.483	0.473	P08101.pdb.gz	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
5	AFDB:Q63203	0.597	0.672	2.331E-30	285	0.446	0.505	Q63203.pdb.gz	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
6	AFDB:P27645	0.649	0.774	3.246E-30	267	0.365	0.442	P27645.pdb.gz	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
7	AFDB:P08508	0.616	0.752	3.480E-29	261	0.378	0.467	P08508.pdb.gz	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
8	AFDB:A0A1W2PQB1	0.538	0.597	5.803E-28	290	0.310	0.345	A0A1W2PQB1.pdb.gz	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
9	AFDB:A0A0B4J1G0	0.554	0.713	3.442E-26	249	0.313	0.406	A0A0B4J1G0.pdb.gz	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
10	AFDB:Q6XPU4	0.550	0.710	3.900E-25	249	0.303	0.394	Q6XPU4.pdb.gz	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
11	PDB:5c6wJ	0.212	0.279	2.089E-7	238	0.108	0.147	5c6wJ.pdb.gz
12	PDB:6dldD	0.189	0.220	2.332E-7	269	0.118	0.141	6dldD.pdb.gz
13	PDB:6dlfA	0.205	0.272	7.852E-7	236	0.127	0.174	6dlfA.pdb.gz
14	PDB:5oj2B	0.205	0.111	2.951E-6	692	0.093	0.043	5oj2B.pdb.gz
15	PDB:1e07A	0.229	0.128	4.849E-6	642	0.127	0.064	1e07A.pdb.gz
16	PDB:1cf8L	0.203	0.276	6.390E-6	215	0.099	0.149	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
17	PDB:1k4dB	0.199	0.289	6.390E-6	212	0.084	0.127	1k4dB.pdb.gz
18	PDB:1ct8A	0.198	0.287	1.050E-5	214	0.096	0.145	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
19	PDB:4xnyL	0.200	0.291	1.172E-5	211	0.087	0.133	4xnyL.pdb.gz
20	PDB:1seqL	0.196	0.290	1.309E-5	208	0.080	0.125	1seqL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P12318	0.0	510	317	0.817	0.833	FCG2A_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-a OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=4
2	P31994	0.0	529	310	0.786	0.819	FCG2B_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-b OS=Homo sapiens OX=9606 GN=FCGR2B PE=1 SV=2
3	P31995	0.0	674	323	1.000	1.000	FCG2C_HUMAN Low affinity immunoglobulin gamma Fc region receptor II-c OS=Homo sapiens OX=9606 GN=FCGR2C PE=1 SV=1
4	P08101	4.54e-97	291	330	0.498	0.488	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
5	Q63203	3.03e-80	247	285	0.440	0.498	FCGR2_RAT Low affinity immunoglobulin gamma Fc region receptor II OS=Rattus norvegicus OX=10116 GN=Fcgr2 PE=1 SV=1
6	P08508	4.43e-75	233	261	0.378	0.467	FCGR3_MOUSE Low affinity immunoglobulin gamma Fc region receptor III OS=Mus musculus OX=10090 GN=Fcgr3 PE=1 SV=1
7	P27645	1.12e-74	232	267	0.347	0.419	FCGR3_RAT Low affinity immunoglobulin gamma Fc region receptor III OS=Rattus norvegicus OX=10116 GN=Fcgr3 PE=2 SV=1
8	A0A0B4J1G0	2.18e-56	185	249	0.303	0.394	FCG3A_MOUSE Low affinity immunoglobulin gamma Fc region receptor III-A OS=Mus musculus OX=10090 GN=Fcgr4 PE=1 SV=1
9	Q6XPU4	5.57e-53	176	249	0.279	0.361	FCG3A_RAT Low affinity immunoglobulin gamma Fc region receptor III-A OS=Rattus norvegicus OX=10116 GN=Fcgr3a PE=2 SV=1
10	A3RFZ7	6.80e-53	176	254	0.294	0.374	FCG3A_MACMU Low affinity immunoglobulin gamma Fc region receptor III-A OS=Macaca mulatta OX=9544 GN=FCGR3A PE=1 SV=1
11	O75015	5.11e-52	173	233	0.263	0.365	FCG3B_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-B OS=Homo sapiens OX=9606 GN=FCGR3B PE=1 SV=2
12	P08637	1.16e-50	170	254	0.288	0.366	FCG3A_HUMAN Low affinity immunoglobulin gamma Fc region receptor III-A OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=2
13	A0A1W2PQB1	4.20e-50	170	290	0.260	0.290	A0A1W2PQB1_HUMAN Fc of IgG low affinity IIIa receptor isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=FCGR3A PE=1 SV=1
14	P12314	3.64e-46	162	374	0.266	0.230	FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens OX=9606 GN=FCGR1A PE=1 SV=2
15	Q92637	1.86e-45	157	280	0.282	0.325	FCGRB_HUMAN Putative high affinity immunoglobulin gamma Fc receptor IB OS=Homo sapiens OX=9606 GN=FCGR1BP PE=5 SV=1
16	P26151	1.33e-43	156	404	0.257	0.205	FCGR1_MOUSE High affinity immunoglobulin gamma Fc receptor I OS=Mus musculus OX=10090 GN=Fcgr1 PE=1 SV=1
17	A0A0B4J2J0	7.59e-42	150	353	0.248	0.227	A0A0B4J2J0_RAT Fc fragment of IgG receptor Ia OS=Rattus norvegicus OX=10116 GN=Fcgr1a PE=4 SV=1
18	P12319	2.09e-40	144	257	0.263	0.331	FCERA_HUMAN High affinity immunoglobulin epsilon receptor subunit alpha OS=Homo sapiens OX=9606 GN=FCER1A PE=1 SV=1
19	V9GY55	8.50e-39	134	86	0.198	0.744	V9GY55_HUMAN Fc gamma receptor IIa (Fragment) OS=Homo sapiens OX=9606 GN=FCGR2A PE=1 SV=1
20	Q6BAA4	5.48e-32	125	426	0.223	0.169	FCRLB_HUMAN Fc receptor-like B OS=Homo sapiens OX=9606 GN=FCRLB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	25	16.2	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF02439 Adeno_E3_CR2	2.1e+02	13.1	Adenovirus E3 region protein CR2
3	PF17957 Big_7	4.3	19.5	Bacterial Ig domain
4	PF07654 C1-set	1.1e+02	14.6	Immunoglobulin C1-set domain
5	PF08205 C2-set_2	3.8	18.9	CD80-like C2-set immunoglobulin domain
6	PF06365 CD34_antigen	2.7e+02	12.6	CD34/Podocalyxin family
7	PF12877 DUF3827	6.1e+02	10.1	Domain of unknown function (DUF3827)
8	PF15820 ECSCR	4.9e+02	12.0	Endothelial cell-specific chemotaxis regulator
9	PF07679 I-set	0.00026	32.3	Immunoglobulin I-set domain
10	PF00047 ig	2.2e-08	45.5	Immunoglobulin domain
11	PF13895 Ig_2	2.6e-22	90.2	Immunoglobulin domain
12	PF13927 Ig_3	1.1e-14	66.0	Immunoglobulin domain
13	PF16680 Ig_4	3.5e-05	35.6	T-cell surface glycoprotein CD3 delta chain
14	PF16681 Ig_5	0.0025	29.5	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
15	PF08374 Protocadherin	1.8e+02	13.5	Protocadherin
16	PF12273 RCR	18	17.4	Chitin synthesis regulation, resistance to Congo red
17	PF07686 V-set	0.00029	32.4	Immunoglobulin V-set domain
18	PF08204 V-set_CD47	2.8e+02	12.9	CD47 immunoglobulin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000000696

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000020857	0.962	LYN proto-oncogene, Src family tyrosine kinase
2	9601.ENSPPYP00000021701	0.951	Spleen tyrosine kinase
3	9601.ENSPPYP00000012270	0.936	Tyrosine-protein kinase
4	9601.ENSPPYP00000000706	0.904	Fc fragment of IgE, high affinity I, receptor for
5	9601.ENSPPYP00000000694	0.897	Uncharacterized protein
6	9601.ENSPPYP00000008263	0.897	Integrin, alpha M (complement component 3 receptor 3 subunit)
7	9601.ENSPPYP00000022369	0.880	annotation not available
8	9601.ENSPPYP00000014855	0.869	Inositol polyphosphate-5-phosphatase, 145kDa
9	9601.ENSPPYP00000000764	0.846	Uncharacterized protein
10	9601.ENSPPYP00000011626	0.846	Leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 4
11	9601.ENSPPYP00000011828	0.833	Uncharacterized protein
12	9601.ENSPPYP00000008264	0.831	Integrin, alpha X (complement component 3 receptor 4 subunit)
13	9601.ENSPPYP00000011635	0.827	annotation not available
14	9601.ENSPPYP00000023741	0.821	Uncharacterized protein
15	9601.ENSPPYP00000011613	0.812	Osteoclast associated, immunoglobulin-like receptor
16	9601.ENSPPYP00000000644	0.809	CD247 molecule
17	9601.ENSPPYP00000007069	0.809	Immunoglobulin heavy variable 3-21
18	9601.ENSPPYP00000007081	0.809	Immunoglobulin heavy variable 1-58
19	9601.ENSPPYP00000000765	0.746	Pentaxin
20	9601.ENSPPYP00000004172	0.743	Inositol polyphosphate phosphatase-like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0038023	0.731	signaling receptor activity
GO:0004888	0.694	transmembrane signaling receptor activity
GO:0019865	0.560	immunoglobulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.990	response to stimulus
GO:0050776	0.986	regulation of immune response
GO:0002697	0.985	regulation of immune effector process
GO:0002683	0.983	negative regulation of immune system process
GO:0009987	0.982	cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0032501	0.976	multicellular organismal process
GO:0007165	0.949	signal transduction
GO:0031347	0.944	regulation of defense response
GO:0002703	0.940	regulation of leukocyte mediated immunity
GO:0002706	0.934	regulation of lymphocyte mediated immunity
GO:0007166	0.928	cell surface receptor signaling pathway
GO:0019222	0.925	regulation of metabolic process
GO:0048584	0.925	positive regulation of response to stimulus
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0006955	0.909	immune response
GO:0002822	0.906	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051239	0.891	regulation of multicellular organismal process
GO:0050777	0.889	negative regulation of immune response
GO:0002698	0.879	negative regulation of immune effector process
GO:0002712	0.877	regulation of B cell mediated immunity
GO:0050778	0.874	positive regulation of immune response
GO:0002889	0.869	regulation of immunoglobulin mediated immune response
GO:0048856	0.851	anatomical structure development
GO:0023051	0.850	regulation of signaling
GO:0002694	0.845	regulation of leukocyte activation
GO:0001775	0.841	cell activation
GO:0051249	0.839	regulation of lymphocyte activation
GO:0001817	0.836	regulation of cytokine production
GO:0010646	0.822	regulation of cell communication
GO:0006950	0.816	response to stress
GO:0002252	0.813	immune effector process
GO:0051049	0.789	regulation of transport
GO:0060627	0.771	regulation of vesicle-mediated transport
GO:0009966	0.757	regulation of signal transduction
GO:0002700	0.755	regulation of production of molecular mediator of immune response
GO:0048523	0.753	negative regulation of cellular process
GO:0009893	0.735	positive regulation of metabolic process
GO:0051241	0.730	negative regulation of multicellular organismal process
GO:0050727	0.711	regulation of inflammatory response
GO:0002707	0.705	negative regulation of lymphocyte mediated immunity
GO:0002699	0.702	positive regulation of immune effector process
GO:0051179	0.694	localization
GO:0001818	0.684	negative regulation of cytokine production
GO:0002695	0.644	negative regulation of leukocyte activation
GO:0006909	0.640	phagocytosis
GO:0002705	0.620	positive regulation of leukocyte mediated immunity
GO:0031348	0.611	negative regulation of defense response
GO:0050764	0.596	regulation of phagocytosis
GO:0002708	0.585	positive regulation of lymphocyte mediated immunity
GO:0031341	0.584	regulation of cell killing
GO:0048522	0.564	positive regulation of cellular process
GO:0001910	0.559	regulation of leukocyte mediated cytotoxicity
GO:0002861	0.543	regulation of inflammatory response to antigenic stimulus
GO:0006952	0.538	defense response
GO:0002831	0.531	regulation of response to biotic stimulus
GO:0002673	0.528	regulation of acute inflammatory response
GO:0002823	0.522	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002920	0.511	regulation of humoral immune response
GO:0010604	0.487	positive regulation of macromolecule metabolic process
GO:0017157	0.413	regulation of exocytosis
GO:0002886	0.390	regulation of myeloid leukocyte mediated immunity
GO:0045321	0.386	leukocyte activation
GO:0030155	0.371	regulation of cell adhesion
GO:0002764	0.369	immune response-regulating signaling pathway
GO:0051051	0.324	negative regulation of transport
GO:0031323	0.320	regulation of cellular metabolic process
GO:0046649	0.318	lymphocyte activation
GO:0042221	0.312	response to chemical
GO:0051171	0.310	regulation of nitrogen compound metabolic process
GO:0006897	0.309	endocytosis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0012505	0.964	endomembrane system
GO:0005737	0.943	cytoplasm
GO:0043226	0.937	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0043229	0.900	intracellular organelle
GO:0043231	0.889	intracellular membrane-bounded organelle
GO:0031982	0.875	vesicle
GO:0097708	0.760	intracellular vesicle
GO:0031410	0.739	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]