StarFunc result for job id P32004

User Input

>input (1257 residues)
MVVALRYVWPLLLCSPCLLIQIPEEYEGHHVMEPPVITEQSPRRLVVFPTDDISLKCEAS
GKPEVQFRWTRDGVHFKPKEELGVTVYQSPHSGSFTITGNNSNFAQRFQGIYRCFASNKL
GTAMSHEIRLMAEGAPKWPKETVKPVEVEEGESVVLPCNPPPSAEPLRIYWMNSKILHIK
QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMIDRKP
RLLFPTNSSSHLVALQGQPLVLECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL
KVGEEDDGEYRCLAENSLGSARHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP
QPEVTWRINGIPVEELAKDQKYRIQRGALILSNVQPSDTMVTQCEARNRHGLLLANAYIY
VVQLPAKILTADNQTYMAVQGSTAYLLCKAFGAPVPSVQWLDEDGTTVLQDERFFPYANG
TLGIRDLQANDTGRYFCLAANDQNNVTIMANLKVKDATQITQGPRSTIEKKGSRVTFTCQ
ASFDPSLQPSITWRGDGRDLQELGDSDKYFIEDGRLVIHSLDYSDQGNYSCVASTELDVV
ESRAQLLVVGSPGPVPRLVLSDLHLLTQSQVRVSWSPAEDHNAPIEKYDIEFEDKEMAPE
KWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPVSETVVTPEAAPEKNPVD
VKGEGNETTNMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPWQEQIVSDPFLVVSNTST
FVPYEIKVQAVNSQGKGPEPQVTIGYSGEDYPQAIPELEGIEILNSSAVLVKWRPVDLAQ
VKGHLRGYNVTYWREGSQRKHSKRHIHKDHVVVPANTTSVILSGLRPYSSYHLEVQAFNG
RGSGPASEFTFSTPEGVPGHPEALHLECQSNTSLLLRWQPPLSHNGVLTGYVLSYHPLDE
GGKGQLSFNLRDPELRTHNLTDLSPHLRYRFQLQATTKEGPGEAIVREGGTMALSGISDF
GNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDL
QPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPPAGFATEGWFIGFVSAIILLLLVLLIL
CFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIK
PLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEAAGGNDSSGATSPINPAVALE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O00533	0.472	0.488	0.000	1208	0.366	0.381	O00533.pdb.gz	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
2	AFDB:O94856	0.327	0.306	0.000	1347	0.379	0.354	O94856.pdb.gz	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
3	AFDB:P11627	0.572	0.571	0.000	1260	0.877	0.875	P11627.pdb.gz	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
4	AFDB:P32004	1.000	1.000	0.000	1257	1.000	1.000	P32004.pdb.gz	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
5	AFDB:P35331	0.366	0.359	0.000	1284	0.395	0.387	P35331.pdb.gz	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
6	AFDB:Q810U4	0.357	0.357	0.000	1256	0.390	0.390	Q810U4.pdb.gz	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
7	AFDB:Q90933	0.394	0.388	0.000	1280	0.477	0.469	Q90933.pdb.gz	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
8	AFDB:P97685	0.379	0.384	8.338E-102	1240	0.347	0.352	P97685.pdb.gz	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
9	AFDB:M0RC17	0.348	0.360	1.335E-100	1210	0.347	0.360	M0RC17.pdb.gz	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
10	AFDB:P20241	0.420	0.409	1.196E-97	1302	0.281	0.271	P20241.pdb.gz	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2
11	PDB:5oj2B	0.132	0.203	2.986E-26	692	0.111	0.202	5oj2B.pdb.gz
12	PDB:1e07A	0.114	0.200	9.174E-20	642	0.091	0.179	1e07A.pdb.gz
13	PDB:5a42A	0.095	0.081	5.748E-17	1597	0.107	0.084	5a42A.pdb.gz
14	PDB:7sqcO0	0.099	0.107	4.813E-15	1140	0.082	0.090	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7q5zA	0.090	0.086	2.014E-14	1344	0.068	0.063	7q5zA.pdb.gz
16	PDB:7q1yA	0.093	0.089	5.891E-14	1374	0.064	0.058	7q1yA.pdb.gz
17	PDB:6h03A	0.104	0.106	2.155E-13	1223	0.053	0.055	6h03A.pdb.gz
18	PDB:4ziqA	0.097	0.089	4.215E-13	1450	0.088	0.077	4ziqA.pdb.gz
19	PDB:6dldD	0.118	0.455	1.031E-12	269	0.042	0.197	6dldD.pdb.gz
20	PDB:7nycA	0.097	0.089	2.306E-12	1542	0.064	0.052	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y8T8	0.0	835	1209	0.387	0.403	A0A8I5Y8T8_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
2	A0A8I5YCG7	0.0	795	1177	0.378	0.404	A0A8I5YCG7_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
3	A0A8I6A9A6	0.0	724	1170	0.318	0.342	A0A8I6A9A6_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=3 SV=1
4	M0RC17	0.0	825	1224	0.387	0.398	M0RC17_RAT Cell adhesion molecule L1-like OS=Rattus norvegicus OX=10116 GN=Chl1 PE=1 SV=3
5	O00533	0.0	823	1208	0.385	0.401	NCHL1_HUMAN Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4
6	O94856	0.0	731	1347	0.313	0.293	NFASC_HUMAN Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4
7	P11627	0.0	2235	1260	0.881	0.879	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
8	P32004	0.0	2614	1257	1.000	1.000	L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens OX=9606 GN=L1CAM PE=1 SV=2
9	P35331	0.0	910	1284	0.404	0.396	NRCAM_CHICK Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1
10	P70232	0.0	834	1209	0.385	0.400	NCHL1_MOUSE Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
11	P97685	0.0	624	1240	0.278	0.281	NFASC_RAT Neurofascin OS=Rattus norvegicus OX=10116 GN=Nfasc PE=1 SV=2
12	P97686	0.0	749	1214	0.318	0.329	NRCAM_RAT Neuronal cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Nrcam PE=1 SV=2
13	Q03696	0.0	1011	1266	0.467	0.464	NGCA_CHICK Neuronal-glial cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=2
14	Q05695	0.0	2244	1259	0.885	0.884	L1CAM_RAT Neural cell adhesion molecule L1 OS=Rattus norvegicus OX=10116 GN=L1cam PE=1 SV=3
15	Q810U3	0.0	620	1240	0.275	0.279	NFASC_MOUSE Neurofascin OS=Mus musculus OX=10090 GN=Nfasc PE=1 SV=1
16	Q810U4	0.0	880	1256	0.399	0.399	NRCAM_MOUSE Neuronal cell adhesion molecule OS=Mus musculus OX=10090 GN=Nrcam PE=1 SV=2
17	Q90478	0.0	811	1197	0.379	0.398	L1CA1_DANRE Neural cell adhesion molecule L1.1 (Fragment) OS=Danio rerio OX=7955 GN=nadl1.1 PE=2 SV=1
18	Q90933	0.0	1066	1280	0.481	0.472	Q90933_CHICK Neuron-glia cell adhesion molecule (Ng-CAM) OS=Gallus gallus OX=9031 PE=2 SV=1
19	Q92823	0.0	885	1304	0.403	0.389	NRCAM_HUMAN Neuronal cell adhesion molecule OS=Homo sapiens OX=9606 GN=NRCAM PE=1 SV=3
20	P20241	1.50e-145	476	1302	0.290	0.280	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	0.44	22.0	Penicillin-Binding Protein C-terminus Family
2	PF13882 Bravo_FIGEY	6.8e-24	96.2	Bravo-like intracellular region
3	PF08205 C2-set_2	1.5e-09	49.1	CD80-like C2-set immunoglobulin domain
4	PF00041 fn3	2.5e-61	215.3	Fibronectin type III domain
5	PF07679 I-set	4.2e-65	227.2	Immunoglobulin I-set domain
6	PF00047 ig	3.2e-39	144.3	Immunoglobulin domain
7	PF13895 Ig_2	8e-41	149.5	Immunoglobulin domain
8	PF13927 Ig_3	1.5e-69	241.8	Immunoglobulin domain
9	PF16680 Ig_4	18	17.3	T-cell surface glycoprotein CD3 delta chain
10	PF16681 Ig_5	0.00022	32.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
11	PF17736 Ig_C17orf99	1.1	20.7	C17orf99 Ig domain
12	PF09294 Interfer-bind	1.4e+02	14.2	Interferon-alpha/beta receptor, fibronectin type III
13	PF16706 Izumo-Ig	5.4	18.3	Izumo-like Immunoglobulin domain
14	PF17861 Laterosporulin	56	15.6	Laterosporulin defensin-like peptide
15	PF16656 Pur_ac_phosph_N	0.00029	32.7	Purple acid Phosphatase, N-terminal domain
16	PF07686 V-set	9e-15	66.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.972	Neuropilin-1
2	9606.ENSP00000252575	0.943	Neurocan core protein
3	9606.ENSP00000261023	0.932	Integrin alpha-V
4	9606.ENSP00000011619	0.930	Ran-binding protein 9
5	9606.ENSP00000362680	0.925	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000275493	0.921	Epidermal growth factor receptor
7	9606.ENSP00000452786	0.912	Integrin beta-3
8	9606.ENSP00000362014	0.910	Dynamin-1
9	9606.ENSP00000356705	0.909	Dynamin-3
10	9606.ENSP00000480132	0.908	Neural cell adhesion molecule 1
11	9606.ENSP00000373905	0.904	Dynamin-2
12	9606.ENSP00000330633	0.900	Contactin-2
13	9606.ENSP00000356042	0.892	Ezrin
14	9606.ENSP00000447006	0.892	Contactin-1
15	9606.ENSP00000483985	0.886	Signal transducer CD24
16	9606.ENSP00000347532	0.872	Shootin-1
17	9606.ENSP00000305988	0.871	CD166 antigen
18	9606.ENSP00000363763	0.864	Ephrin type-B receptor 2
19	9606.ENSP00000383392	0.860	Neural cell adhesion molecule 2
20	9606.ENSP00000393312	0.836	Fibroblast growth factor receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.999	protein domain specific binding
GO:0050839	0.366	cell adhesion molecule binding
GO:0043167	0.320	ion binding
GO:0042802	0.308	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0032501	0.978	multicellular organismal process
GO:0050896	0.977	response to stimulus
GO:0032502	0.975	developmental process
GO:0048856	0.974	anatomical structure development
GO:0007275	0.963	multicellular organism development
GO:0071840	0.958	cellular component organization or biogenesis
GO:0050789	0.945	regulation of biological process
GO:0048731	0.933	system development
GO:0050794	0.931	regulation of cellular process
GO:0016043	0.928	cellular component organization
GO:0030154	0.856	cell differentiation
GO:0007399	0.835	nervous system development
GO:0009653	0.817	anatomical structure morphogenesis
GO:0042221	0.816	response to chemical
GO:0007155	0.805	cell adhesion
GO:0048468	0.754	cell development
GO:0030030	0.747	cell projection organization
GO:0022008	0.715	neurogenesis
GO:0030182	0.640	neuron differentiation
GO:0048666	0.613	neuron development
GO:0000902	0.592	cell morphogenesis
GO:0031175	0.590	neuron projection development
GO:0061564	0.532	axon development
GO:0048518	0.495	positive regulation of biological process
GO:0051716	0.428	cellular response to stimulus
GO:0048522	0.414	positive regulation of cellular process
GO:0040011	0.381	locomotion
GO:0007154	0.358	cell communication
GO:0032990	0.324	cell part morphogenesis
GO:0023052	0.308	signaling
GO:0007165	0.304	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0042995	0.995	cell projection
GO:0120025	0.993	plasma membrane bounded cell projection
GO:0030054	0.992	cell junction
GO:0043005	0.966	neuron projection
GO:0030424	0.919	axon
GO:0031982	0.853	vesicle
GO:0005737	0.816	cytoplasm
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0070161	0.547	anchoring junction
GO:0009986	0.520	cell surface
GO:0030055	0.499	cell-substrate junction
GO:0036477	0.448	somatodendritic compartment
GO:0005925	0.445	focal adhesion
GO:0098590	0.439	plasma membrane region
GO:0045202	0.410	synapse
GO:0044297	0.408	cell body
GO:0043025	0.354	neuronal cell body
GO:0005576	0.323	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]