StarFunc result for job id P32019

User Input

>input (993 residues)
MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRM
AITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRM
FLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGRY
PSRKKRWGLEEARPQGAGSVLFWGGAMEKTGFRLMERAHGGGFVWGRSARDGRRDEELEE
AGREMSAAAGSRERNTAGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITD
MVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQKEEDYTYIQNFRFFAGTYNVNGQSPK
ECLRLWLSNGIQAPDVYCVGFQELDLSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAKVK
LIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIMGRMGNKGGVAIRFQFHNTSICVVNSH
LAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILWLGDLNYRIEELDVEKV
KKLIEEKDFQMLYAYDQLKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTSEKCRAP
AWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNDELYRKTLEEIVRSLD
KMENANIPSVSLSKREFCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLN
ANPSRGFLLPDSDVEIDLELFVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYL
PSCFGSPIHTLCYMREPILDLPLETISELTLMPVWTGDDGSQLDSPMEIPKELWMMVDYL
YRNAVQQEDLFQQPGLRSEFEHIRDCLDTGMIDNLSASNHSVAEALLLFLESLPEPVICY
STYHNCLECSGNYTASKQVISTLPIFHKNVFHYLMAFLRELLKNSAKNHLDENILASIFG
SLLLRNPAGHQKLDMTEKKKAQEFIHQFLCNPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7ESY0	0.490	0.648	0.000	748	0.734	0.975	E7ESY0.pdb.gz	E7ESY0_HUMAN phosphoinositide 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=2
2	AFDB:P32019	1.000	1.000	0.000	993	1.000	1.000	P32019.pdb.gz	I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=4
3	AFDB:Q8K337	0.693	0.693	0.000	993	0.832	0.832	Q8K337.pdb.gz	I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus OX=10090 GN=Inpp5b PE=1 SV=1
4	AFDB:Q8I7P3	0.557	0.686	2.201E-74	787	0.292	0.368	Q8I7P3.pdb.gz	Q8I7P3_DICDI Inositol 5-phosphatase 4 OS=Dictyostelium discoideum OX=44689 GN=Dd5P4 PE=3 SV=1
5	AFDB:O46094	0.470	0.535	1.113E-67	850	0.267	0.312	O46094.pdb.gz	O46094_DROME EG:86E4.5 protein OS=Drosophila melanogaster OX=7227 GN=Ocrl PE=1 SV=1
6	AFDB:B1ARF3	0.155	0.473	1.883E-33	319	0.268	0.834	B1ARF3.pdb.gz	B1ARF3_HUMAN Inositol polyphosphate-5-phosphatase B OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=1
7	AFDB:P59644	0.279	0.277	3.220E-29	1003	0.144	0.143	P59644.pdb.gz	PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus OX=10090 GN=Inpp5j PE=1 SV=2
8	AFDB:A0A2R8QHM1	0.322	0.238	6.584E-28	1354	0.134	0.098	A0A2R8QHM1.pdb.gz
9	AFDB:W5UIG7	0.281	0.250	2.474E-21	1118	0.114	0.101	W5UIG7.pdb.gz	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
10	PDB:2imqX	0.242	0.793	2.109E-18	280	0.079	0.279	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
11	PDB:6r3vA	0.144	0.649	4.562E-8	198	0.046	0.232	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.146	0.347	5.842E-8	402	0.036	0.090	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:4f1iA	0.178	0.468	7.121E-8	328	0.041	0.125	4f1iA.pdb.gz
14	PDB:2j63A	0.163	0.390	8.260E-8	333	0.043	0.129	2j63A.pdb.gz
15	PDB:1xa6A	0.157	0.379	1.355E-7	399	0.037	0.093	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
16	PDB:5c2kA	0.155	0.389	2.222E-7	382	0.029	0.076	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
17	PDB:4awnA	0.172	0.511	5.152E-7	260	0.040	0.154	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
18	AFDB:P27864	0.162	0.221	6.801E-7	679	0.076	0.110	P27864.pdb.gz	RRP1_DROME Recombination repair protein 1 OS=Drosophila melanogaster OX=7227 GN=Rrp1 PE=1 SV=2
19	PDB:7ax1A	0.171	0.295	2.637E-6	518	0.053	0.102	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
20	PDB:7sqcO0	0.105	0.093	3.059E-6	1140	0.043	0.038	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IPY6	0.0	799	961	0.394	0.407	A0A0R4IPY6_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=1
2	B1ARF3	0.0	534	319	0.260	0.809	B1ARF3_HUMAN Inositol polyphosphate-5-phosphatase B OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=1
3	D3ZGS3	0.0	796	902	0.390	0.429	OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL OS=Rattus norvegicus OX=10116 GN=Ocrl PE=1 SV=1
4	E7ESY0	0.0	1157	748	0.556	0.738	E7ESY0_HUMAN phosphoinositide 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=2
5	F1QIY4	0.0	803	953	0.394	0.410	F1QIY4_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=2
6	P32019	0.0	2076	993	1.000	1.000	I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=4
7	Q01968	0.0	801	901	0.391	0.431	OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3
8	Q6NVF0	0.0	788	900	0.378	0.417	OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL OS=Mus musculus OX=10090 GN=Ocrl PE=1 SV=1
9	Q8K337	0.0	1714	993	0.833	0.833	I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus OX=10090 GN=Inpp5b PE=1 SV=1
10	Q8I7P3	7.52e-164	502	787	0.288	0.363	Q8I7P3_DICDI Inositol 5-phosphatase 4 OS=Dictyostelium discoideum OX=44689 GN=Dd5P4 PE=3 SV=1
11	O46094	2.37e-124	400	850	0.239	0.279	O46094_DROME EG:86E4.5 protein OS=Drosophila melanogaster OX=7227 GN=Ocrl PE=1 SV=1
12	Q95R90	8.93e-89	296	521	0.181	0.345	Q95R90_DROME LP11751p OS=Drosophila melanogaster OX=7227 GN=Ocrl PE=2 SV=1
13	Q54PV1	1.20e-61	232	1800	0.128	0.071	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
14	Q8MR94	6.25e-60	224	959	0.138	0.143	Q8MR94_DROME phosphoinositide 5-phosphatase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Synj PE=2 SV=1
15	P50942	6.85e-60	226	1183	0.128	0.107	INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP52 PE=1 SV=1
16	E9QHF3	1.63e-59	224	1308	0.144	0.109	E9QHF3_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=fb02f11 PE=1 SV=2
17	Q5U0V7	3.26e-59	223	1218	0.138	0.112	Q5U0V7_DROME phosphoinositide 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=Synj PE=1 SV=1
18	G5ECL2	1.49e-58	221	1119	0.136	0.121	SYNJ_CAEEL Synaptojanin OS=Caenorhabditis elegans OX=6239 GN=unc-26 PE=1 SV=1
19	Q62910	8.26e-58	220	1574	0.146	0.092	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
20	Q8CHC4	9.78e-58	219	1574	0.142	0.090	SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus OX=10090 GN=Synj1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1.5e-11	55.9	Endonuclease/Exonuclease/phosphatase family
2	PF16776 INPP5B_PH	1.4e-55	198.5	Type II inositol 1,4,5-trisphosphate 5-phosphatase PH domain
3	PF00620 RhoGAP	1e-20	85.6	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000052529

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000051433	0.994	SAC1 suppressor of actin mutations 1-like (yeast)
2	9598.ENSPTRP00000028272	0.992	Inositol polyphosphate-4-phosphatase, type II, 105kDa
3	9598.ENSPTRP00000004739	0.972	Multiple inositol-polyphosphate phosphatase 1
4	9598.ENSPTRP00000021784	0.969	Inositol polyphosphate-1-phosphatase
5	9598.ENSPTRP00000045047	0.942	Inositol polyphosphate-5-phosphatase F
6	9598.ENSPTRP00000002179	0.937	Pan troglodytes phosphatidylinositol-4-phosphate 5-kinase, type I, alpha (PIP5K1A), mRNA
7	9598.ENSPTRP00000043523	0.937	Uncharacterized protein
8	9598.ENSPTRP00000039019	0.929	Inositol polyphosphate-4-phosphatase type I A
9	9598.ENSPTRP00000048893	0.916	Phosphatidylinositol-4-phosphate 5-kinase-like 1
10	9598.ENSPTRP00000034913	0.909	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
11	9598.ENSPTRP00000004746	0.908	Tumor suppressor. Acts as a dual-specificity protein phosphatase, dephosphorylating tyrosine-, serine- and threonine- phosphorylated proteins. Also acts as a lipid phosphatase.
12	9598.ENSPTRP00000010345	0.906	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
13	9598.ENSPTRP00000004336	0.903	Kinase
14	9598.ENSPTRP00000053686	0.902	Transmembrane phosphoinositide 3-phosphatase and tensin homolog 2
15	9598.ENSPTRP00000053992	0.898	Uncharacterized protein
16	9598.ENSPTRP00000011352	0.894	Inositol-tetrakisphosphate 1-kinase
17	9598.ENSPTRP00000038894	0.892	Uncharacterized protein
18	9598.ENSPTRP00000047269	0.892	Uncharacterized protein
19	9598.ENSPTRP00000031984	0.890	Synaptojanin 2
20	9598.ENSPTRP00000003459	0.888	Kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046030	1.000	inositol trisphosphate phosphatase activity
GO:0004439	1.000	phosphatidylinositol-4,5-bisphosphate 5-phosphatase activity
GO:0005515	0.999	protein binding
GO:0052658	0.777	inositol-1,4,5-trisphosphate 5-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0019637	0.983	organophosphate metabolic process
GO:0046488	0.970	phosphatidylinositol metabolic process
GO:0046856	0.908	phosphatidylinositol dephosphorylation
GO:0050789	0.788	regulation of biological process
GO:0019751	0.662	polyol metabolic process
GO:0043647	0.555	inositol phosphate metabolic process
GO:0050794	0.453	regulation of cellular process
GO:0050896	0.446	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0071944	0.994	cell periphery
GO:0005886	0.959	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22764	1.000	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol 4-phosphate) + phosphate
EC:3.1.3.36	1.000	phosphoinositide 5-phosphatase.
RHEA:19797	0.777	1D-myo-inositol 1,4,5-trisphosphate + H2O = 1D-myo-inositol 1,4-bisphosphate + phosphate
EC:3.1.3.56	0.777	inositol-polyphosphate 5-phosphatase.

[back to server]