StarFunc result for job id P32246

User Input

>input (355 residues)
METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32246	1.000	1.000	1.193E-47	355	1.000	1.000	P32246.pdb.gz	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
2	AFDB:P51675	0.924	0.924	1.312E-38	355	0.800	0.800	P51675.pdb.gz	CCR1_MOUSE C-C chemokine receptor type 1 OS=Mus musculus OX=10090 GN=Ccr1 PE=2 SV=2
3	PDB:7vl9R	0.799	0.934	6.455E-35	302	0.848	0.997	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
4	AFDB:O54814	0.876	0.867	5.423E-34	359	0.614	0.607	O54814.pdb.gz	CCR3_RAT C-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Ccr3 PE=2 SV=1
5	AFDB:A1LPE5	0.884	0.884	3.585E-33	355	0.625	0.625	A1LPE5.pdb.gz
6	AFDB:O55193	0.857	0.816	8.686E-31	373	0.552	0.525	O55193.pdb.gz	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
7	AFDB:P51681	0.875	0.882	1.471E-30	352	0.552	0.557	P51681.pdb.gz	CCR5_HUMAN C-C chemokine receptor type 5 OS=Homo sapiens OX=9606 GN=CCR5 PE=1 SV=1
8	AFDB:O08556	0.884	0.886	3.867E-30	354	0.538	0.540	O08556.pdb.gz	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
9	AFDB:P41597	0.816	0.775	6.039E-28	374	0.501	0.476	P41597.pdb.gz	CCR2_HUMAN C-C chemokine receptor type 2 OS=Homo sapiens OX=9606 GN=CCR2 PE=1 SV=1
10	AFDB:G3V7C3	0.826	0.815	1.069E-27	360	0.485	0.478	G3V7C3.pdb.gz	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
11	AFDB:A0N0Q1	0.823	0.812	2.526E-26	360	0.462	0.456	A0N0Q1.pdb.gz	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
12	PDB:7f1qR	0.786	0.761	7.421E-26	367	0.504	0.488	7f1qR.pdb.gz
13	PDB:7f1tA	0.786	0.662	2.538E-25	423	0.499	0.418	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
14	PDB:7x9yR	0.763	0.915	9.305E-24	293	0.546	0.662	7x9yR.pdb.gz
15	PDB:5t1aA	0.752	0.603	1.219E-21	445	0.470	0.375	5t1aA.pdb.gz	Structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists.
16	PDB:7f1rR	0.718	0.776	4.170E-21	327	0.479	0.520	7f1rR.pdb.gz
17	PDB:6wwzR	0.771	0.876	7.479E-17	310	0.307	0.352	6wwzR.pdb.gz
18	PDB:8ef5M	0.708	0.861	2.146E-16	288	0.242	0.299	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
19	PDB:6lfmR	0.746	0.855	8.015E-16	307	0.304	0.352	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
20	PDB:7f6hA	0.756	0.874	1.419E-15	305	0.251	0.292	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32246	0.0	727	355	1.000	1.000	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1
2	P51675	0.0	577	355	0.800	0.800	CCR1_MOUSE C-C chemokine receptor type 1 OS=Mus musculus OX=10090 GN=Ccr1 PE=2 SV=2
3	P51678	4.38e-166	469	359	0.637	0.630	CCR3_MOUSE Probable C-C chemokine receptor type 3 OS=Mus musculus OX=10090 GN=Ccr3 PE=2 SV=2
4	O54814	1.92e-161	457	359	0.617	0.610	CCR3_RAT C-C chemokine receptor type 3 OS=Rattus norvegicus OX=10116 GN=Ccr3 PE=2 SV=1
5	P51677	6.34e-153	436	355	0.625	0.625	CCR3_HUMAN C-C chemokine receptor type 3 OS=Homo sapiens OX=9606 GN=CCR3 PE=1 SV=1
6	O55193	2.32e-141	407	373	0.558	0.531	CCR2_RAT C-C chemokine receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ccr2 PE=2 SV=1
7	P51682	3.67e-141	406	354	0.546	0.548	CCR5_MOUSE C-C chemokine receptor type 5 OS=Mus musculus OX=10090 GN=Ccr5 PE=2 SV=3
8	P51683	1.35e-139	402	373	0.549	0.523	CCR2_MOUSE C-C chemokine receptor type 2 OS=Mus musculus OX=10090 GN=Ccr2 PE=1 SV=2
9	P51681	7.26e-136	392	352	0.555	0.560	CCR5_HUMAN C-C chemokine receptor type 5 OS=Homo sapiens OX=9606 GN=CCR5 PE=1 SV=1
10	O08556	1.58e-132	384	354	0.538	0.540	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
11	P41597	3.25e-128	374	374	0.518	0.492	CCR2_HUMAN C-C chemokine receptor type 2 OS=Homo sapiens OX=9606 GN=CCR2 PE=1 SV=1
12	P51680	1.53e-116	343	360	0.490	0.483	CCR4_MOUSE C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2
13	G3V7C3	1.54e-115	341	360	0.473	0.467	G3V7C3_RAT C-C motif chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=3 SV=1
14	Q91ZH4	1.87e-115	341	360	0.473	0.467	Q91ZH4_RAT C-C chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=2 SV=2
15	A0N0Q1	1.31e-113	336	360	0.468	0.461	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
16	P51679	1.31e-113	336	360	0.468	0.461	CCR4_HUMAN C-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=1 SV=1
17	F1QYD4	2.01e-87	269	358	0.392	0.388	F1QYD4_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.3 PE=3 SV=3
18	P56484	3.98e-87	268	353	0.392	0.394	CCR8_MOUSE C-C chemokine receptor type 8 OS=Mus musculus OX=10090 GN=Ccr8 PE=2 SV=1
19	P51685	1.92e-84	261	355	0.406	0.406	CCR8_HUMAN C-C chemokine receptor type 8 OS=Homo sapiens OX=9606 GN=CCR8 PE=1 SV=1
20	A0A140LFQ7	2.50e-82	256	354	0.358	0.359	A0A140LFQ7_DANRE C-C chemokine receptor type 5-like OS=Danio rerio OX=7955 GN=si:ch211-207g17.2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	3.4e-55	198.8	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	6.7e-05	34.0	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10328 7TM_GPCR_Srx	0.13	23.4	Serpentine type 7TM GPCR chemoreceptor Srx
4	PF06836 DUF1240	59	15.7	Protein of unknown function (DUF1240)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296140

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000474412	0.999	C-C motif chemokine 5
2	9606.ENSP00000477908	0.999	C-C motif chemokine 3
3	9606.ENSP00000367832	0.998	C-C motif chemokine 7
4	9606.ENSP00000484078	0.997	C-C motif chemokine 15
5	9606.ENSP00000378118	0.995	C-C motif chemokine 8
6	9606.ENSP00000478024	0.995	C-C motif chemokine 16
7	9606.ENSP00000482259	0.990	C-C motif chemokine 4
8	9606.ENSP00000225831	0.987	C-C motif chemokine 2
9	9606.ENSP00000480558	0.977	C-C motif chemokine 3-like 1
10	9606.ENSP00000412237	0.957	Interleukin-10
11	9606.ENSP00000479097	0.955	C-C motif chemokine ligand 14
12	9606.ENSP00000259206	0.953	Interleukin-1 receptor antagonist protein
13	9606.ENSP00000225844	0.952	C-C motif chemokine 13
14	9606.ENSP00000365435	0.941	Tumor necrosis factor receptor superfamily member 1B
15	9606.ENSP00000362965	0.930	Platelet-activating factor receptor
16	9606.ENSP00000483609	0.930	C-C motif chemokine 4-like
17	9606.ENSP00000305651	0.911	C-X-C motif chemokine 10
18	9606.ENSP00000006053	0.899	Fractalkine
19	9606.ENSP00000403701	0.895	Beta-arrestin-2
20	9606.ENSP00000225842	0.892	C-C motif chemokine 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0004950	1.000	chemokine receptor activity
GO:0019957	0.992	C-C chemokine binding
GO:0016493	0.991	C-C chemokine receptor activity
GO:0005102	0.411	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0009987	0.990	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0042221	0.985	response to chemical
GO:0051716	0.949	cellular response to stimulus
GO:0048518	0.933	positive regulation of biological process
GO:0007154	0.922	cell communication
GO:0023052	0.911	signaling
GO:0007165	0.895	signal transduction
GO:0002376	0.879	immune system process
GO:0006950	0.792	response to stress
GO:0048522	0.789	positive regulation of cellular process
GO:0006935	0.783	chemotaxis
GO:0048583	0.720	regulation of response to stimulus
GO:0006952	0.666	defense response
GO:0051239	0.662	regulation of multicellular organismal process
GO:0070887	0.612	cellular response to chemical stimulus
GO:0006954	0.603	inflammatory response
GO:0032501	0.569	multicellular organismal process
GO:0002682	0.495	regulation of immune system process
GO:0002684	0.490	positive regulation of immune system process
GO:0010033	0.470	response to organic substance
GO:0048584	0.462	positive regulation of response to stimulus
GO:0044419	0.461	biological process involved in interspecies interaction between organisms
GO:0048519	0.455	negative regulation of biological process
GO:0019222	0.440	regulation of metabolic process
GO:0006955	0.434	immune response
GO:0048523	0.427	negative regulation of cellular process
GO:0023051	0.424	regulation of signaling
GO:0010646	0.424	regulation of cell communication
GO:0060255	0.423	regulation of macromolecule metabolic process
GO:0032101	0.421	regulation of response to external stimulus
GO:0009607	0.405	response to biotic stimulus
GO:0050793	0.404	regulation of developmental process
GO:0051707	0.399	response to other organism
GO:0009966	0.399	regulation of signal transduction
GO:0009893	0.387	positive regulation of metabolic process
GO:0032502	0.377	developmental process
GO:0007166	0.372	cell surface receptor signaling pathway
GO:0010468	0.367	regulation of gene expression
GO:0048856	0.361	anatomical structure development
GO:0010604	0.343	positive regulation of macromolecule metabolic process
GO:0051240	0.336	positive regulation of multicellular organismal process
GO:0048870	0.328	cell motility
GO:0034097	0.324	response to cytokine
GO:0071310	0.322	cellular response to organic substance
GO:0032103	0.301	positive regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.802	extracellular region
GO:0043231	0.784	intracellular membrane-bounded organelle
GO:0005737	0.704	cytoplasm
GO:0009986	0.431	cell surface
GO:0098552	0.371	side of membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]