StarFunc result for job id P32248

User Input

>input (378 residues)
MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWF
LPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWVFGVHFCKLIFAIYKMSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
GIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFITIQVAQMVIGFLVPLLAMS
FCYLVIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFNITSSTCEL
SKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSQEQLRQWSSCRH
IRRSSMSVEAETTTTFSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0N0Q0	0.886	0.886	4.077E-46	378	1.000	1.000	A0N0Q0.pdb.gz	A0N0Q0_HUMAN Chemokine (C-C motif) receptor 7 OS=Homo sapiens OX=9606 GN=CCR7 PE=2 SV=1
2	AFDB:P47774	0.883	0.883	9.775E-43	378	0.870	0.870	P47774.pdb.gz	CCR7_MOUSE C-C chemokine receptor type 7 OS=Mus musculus OX=10090 GN=Ccr7 PE=1 SV=2
3	AFDB:F1QLM4	0.795	0.781	1.498E-25	385	0.484	0.475	F1QLM4.pdb.gz
4	AFDB:Q568F5	0.798	0.748	4.495E-25	404	0.394	0.369	Q568F5.pdb.gz	Q568F5_DANRE LOC553366 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC553366 PE=2 SV=1
5	AFDB:A0A060YGE9	0.815	0.821	1.349E-24	375	0.447	0.451	A0A060YGE9.pdb.gz	A0A060YGE9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00048959001 PE=3 SV=1
6	AFDB:P51684	0.776	0.784	5.665E-23	374	0.394	0.398	P51684.pdb.gz	CCR6_HUMAN C-C chemokine receptor type 6 OS=Homo sapiens OX=9606 GN=CCR6 PE=1 SV=2
7	AFDB:Q5BK58	0.771	0.796	4.884E-22	366	0.381	0.393	Q5BK58.pdb.gz	Q5BK58_RAT C-C motif chemokine receptor 6 OS=Rattus norvegicus OX=10116 GN=Ccr6 PE=1 SV=1
8	AFDB:Q9WUT7	0.780	0.798	9.870E-22	369	0.389	0.398	Q9WUT7.pdb.gz	CCR9_MOUSE C-C chemokine receptor type 9 OS=Mus musculus OX=10090 GN=Ccr9 PE=2 SV=1
9	AFDB:O54689	0.771	0.793	1.748E-21	367	0.381	0.392	O54689.pdb.gz	CCR6_MOUSE C-C chemokine receptor type 6 OS=Mus musculus OX=10090 GN=Ccr6 PE=1 SV=1
10	AFDB:O08556	0.740	0.789	2.084E-21	354	0.331	0.353	O08556.pdb.gz	CCR5_RAT C-C chemokine receptor type 5 OS=Rattus norvegicus OX=10116 GN=Ccr5 PE=2 SV=1
11	PDB:7f1qR	0.700	0.720	2.534E-18	367	0.302	0.311	7f1qR.pdb.gz
12	PDB:6wwzR	0.725	0.872	6.106E-18	310	0.376	0.458	6wwzR.pdb.gz
13	PDB:7vl9R	0.719	0.889	4.614E-17	302	0.320	0.401	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
14	PDB:7f1tA	0.690	0.620	1.488E-15	423	0.291	0.260	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
15	PDB:6lfmR	0.691	0.841	1.774E-15	307	0.310	0.381	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
16	PDB:7sk8A	0.694	0.847	1.030E-14	306	0.246	0.304	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
17	PDB:5t1aA	0.675	0.577	2.081E-14	445	0.294	0.249	5t1aA.pdb.gz	Structure of CC chemokine receptor 2 with orthosteric and allosteric antagonists.
18	PDB:7f1rR	0.655	0.751	4.798E-14	327	0.291	0.336	7f1rR.pdb.gz
19	PDB:7x9yR	0.689	0.876	5.721E-14	293	0.278	0.358	7x9yR.pdb.gz
20	PDB:7eibA	0.703	0.890	1.013E-13	295	0.222	0.285	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0N0Q0	0.0	771	378	1.000	1.000	A0N0Q0_HUMAN Chemokine (C-C motif) receptor 7 OS=Homo sapiens OX=9606 GN=CCR7 PE=2 SV=1
2	J3KSS9	0.0	756	372	0.984	1.000	J3KSS9_HUMAN C-C motif chemokine receptor 7 OS=Homo sapiens OX=9606 GN=CCR7 PE=1 SV=1
3	P32248	0.0	771	378	1.000	1.000	CCR7_HUMAN C-C chemokine receptor type 7 OS=Homo sapiens OX=9606 GN=CCR7 PE=1 SV=2
4	P47774	0.0	652	378	0.870	0.870	CCR7_MOUSE C-C chemokine receptor type 7 OS=Mus musculus OX=10090 GN=Ccr7 PE=1 SV=2
5	L7UKG5	6.92e-115	340	352	0.474	0.509	L7UKG5_ONCMY CC chemokine receptor 7 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
6	A5PLI3	8.68e-111	330	372	0.481	0.489	A5PLI3_DANRE C-C chemokine receptor type 7 precursor OS=Danio rerio OX=7955 GN=ccr7 PE=2 SV=1
7	A0A060YGE9	8.35e-107	320	375	0.450	0.453	A0A060YGE9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00048959001 PE=3 SV=1
8	B0V1K7	1.56e-98	299	369	0.407	0.417	B0V1K7_DANRE C-C chemokine receptor type 9 OS=Danio rerio OX=7955 GN=sb:eu630 PE=3 SV=1
9	Q568F5	5.58e-98	298	404	0.407	0.381	Q568F5_DANRE LOC553366 protein (Fragment) OS=Danio rerio OX=7955 GN=LOC553366 PE=2 SV=1
10	P51686	2.31e-96	293	369	0.389	0.398	CCR9_HUMAN C-C chemokine receptor type 9 OS=Homo sapiens OX=9606 GN=CCR9 PE=1 SV=2
11	Q9WUT7	8.21e-96	292	369	0.405	0.415	CCR9_MOUSE C-C chemokine receptor type 9 OS=Mus musculus OX=10090 GN=Ccr9 PE=2 SV=1
12	Q5BK58	1.28e-90	278	366	0.394	0.407	Q5BK58_RAT C-C motif chemokine receptor 6 OS=Rattus norvegicus OX=10116 GN=Ccr6 PE=1 SV=1
13	O54689	4.99e-89	275	367	0.413	0.425	CCR6_MOUSE C-C chemokine receptor type 6 OS=Mus musculus OX=10090 GN=Ccr6 PE=1 SV=1
14	P51684	2.84e-88	273	374	0.407	0.412	CCR6_HUMAN C-C chemokine receptor type 6 OS=Homo sapiens OX=9606 GN=CCR6 PE=1 SV=2
15	Q9EQ16	2.60e-80	251	351	0.362	0.390	CXCR6_MOUSE C-X-C chemokine receptor type 6 OS=Mus musculus OX=10090 GN=Cxcr6 PE=1 SV=1
16	Q9NPB9	8.12e-78	245	350	0.370	0.400	ACKR4_HUMAN Atypical chemokine receptor 4 OS=Homo sapiens OX=9606 GN=ACKR4 PE=1 SV=1
17	A0N0Q1	1.95e-74	237	360	0.333	0.350	A0N0Q1_HUMAN Chemokine (C-C motif) receptor 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=2 SV=1
18	P51679	1.95e-74	237	360	0.333	0.350	CCR4_HUMAN C-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CCR4 PE=1 SV=1
19	P51680	8.71e-73	233	360	0.328	0.344	CCR4_MOUSE C-C chemokine receptor type 4 OS=Mus musculus OX=10090 GN=Ccr4 PE=2 SV=2
20	Q91ZH4	6.65e-72	230	360	0.336	0.353	Q91ZH4_RAT C-C chemokine receptor 4 OS=Rattus norvegicus OX=10116 GN=Ccr4 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.2e-48	175.2	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	0.14	23.1	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF04789 DUF621	3.5e+02	11.7	Protein of unknown function (DUF621)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246657

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259607	0.999	C-C motif chemokine 21
2	9606.ENSP00000308815	0.998	C-C motif chemokine 19
3	9606.ENSP00000379140	0.950	Stromal cell-derived factor 1
4	9606.ENSP00000286758	0.927	C-X-C motif chemokine 13
5	9606.ENSP00000236147	0.910	L-selectin
6	9606.ENSP00000266557	0.899	CD27 antigen
7	9606.ENSP00000011653	0.892	T-cell surface glycoprotein CD4
8	9606.ENSP00000474412	0.892	C-C motif chemokine 5
9	9606.ENSP00000386559	0.891	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000351671	0.888	C-C motif chemokine 20
11	9606.ENSP00000375086	0.888	C-C motif chemokine 25
12	9606.ENSP00000482259	0.888	C-C motif chemokine 4
13	9606.ENSP00000354901	0.880	C-X-C motif chemokine 9
14	9606.ENSP00000477908	0.877	C-C motif chemokine 3
15	9606.ENSP00000305651	0.876	C-X-C motif chemokine 10
16	9606.ENSP00000306157	0.867	Interleukin-7 receptor subunit alpha
17	9606.ENSP00000332049	0.866	T-lymphocyte activation antigen CD86
18	9606.ENSP00000324890	0.865	T-cell-specific surface glycoprotein CD28
19	9606.ENSP00000356792	0.863	Lymphotactin
20	9606.ENSP00000225831	0.861	C-C motif chemokine 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004950	1.000	chemokine receptor activity
GO:0005515	0.996	protein binding
GO:0016493	0.994	C-C chemokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0051716	0.964	cellular response to stimulus
GO:0042221	0.939	response to chemical
GO:0023052	0.897	signaling
GO:0007154	0.893	cell communication
GO:0048518	0.875	positive regulation of biological process
GO:0002376	0.865	immune system process
GO:0007165	0.861	signal transduction
GO:0040011	0.795	locomotion
GO:0009605	0.790	response to external stimulus
GO:0048522	0.763	positive regulation of cellular process
GO:0048583	0.762	regulation of response to stimulus
GO:0019222	0.710	regulation of metabolic process
GO:0032501	0.676	multicellular organismal process
GO:0006950	0.660	response to stress
GO:0042330	0.609	taxis
GO:0060255	0.599	regulation of macromolecule metabolic process
GO:0006952	0.536	defense response
GO:0002684	0.494	positive regulation of immune system process
GO:0006955	0.487	immune response
GO:0009893	0.482	positive regulation of metabolic process
GO:0051239	0.481	regulation of multicellular organismal process
GO:0010468	0.475	regulation of gene expression
GO:0048519	0.469	negative regulation of biological process
GO:0010604	0.460	positive regulation of macromolecule metabolic process
GO:0031323	0.459	regulation of cellular metabolic process
GO:0048584	0.457	positive regulation of response to stimulus
GO:0080090	0.452	regulation of primary metabolic process
GO:0051171	0.451	regulation of nitrogen compound metabolic process
GO:0048523	0.442	negative regulation of cellular process
GO:0051240	0.438	positive regulation of multicellular organismal process
GO:0040012	0.426	regulation of locomotion
GO:0044419	0.402	biological process involved in interspecies interaction between organisms
GO:0009966	0.390	regulation of signal transduction
GO:0048856	0.368	anatomical structure development
GO:0070887	0.355	cellular response to chemical stimulus
GO:0007166	0.351	cell surface receptor signaling pathway
GO:0042127	0.331	regulation of cell population proliferation
GO:0051707	0.319	response to other organism
GO:0010033	0.315	response to organic substance
GO:0006935	0.303	chemotaxis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0043227	0.997	membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0005737	0.995	cytoplasm
GO:0005886	0.992	plasma membrane
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005739	0.801	mitochondrion
GO:0009986	0.746	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]