StarFunc result for job id P32297

User Input

>input (505 residues)
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32297	1.000	1.000	3.024E-92	505	1.000	1.000	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
2	AFDB:P09481	0.849	0.864	8.708E-77	496	0.806	0.821	P09481.pdb.gz	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
3	AFDB:Q15825	0.822	0.840	5.371E-67	494	0.642	0.656	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
4	AFDB:Q9R0W9	0.813	0.831	1.609E-66	494	0.608	0.621	Q9R0W9.pdb.gz	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
5	AFDB:Q15822	0.788	0.752	2.508E-61	529	0.560	0.535	Q15822.pdb.gz	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
6	AFDB:Q91X60	0.807	0.796	4.848E-60	512	0.562	0.555	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
7	AFDB:B3DGY1	0.792	0.770	4.349E-59	520	0.568	0.552	B3DGY1.pdb.gz
8	AFDB:P43681	0.774	0.626	2.254E-58	627	0.586	0.472	P43681.pdb.gz	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
9	AFDB:P09483	0.770	0.619	4.353E-58	630	0.592	0.475	P09483.pdb.gz	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
10	AFDB:P09482	0.776	0.632	4.599E-58	622	0.568	0.461	P09482.pdb.gz	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
11	PDB:6i53B	0.529	0.774	1.414E-22	338	0.131	0.195	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:4aq5E	0.494	0.652	1.761E-22	370	0.250	0.341	4aq5E.pdb.gz
13	PDB:6i53A	0.533	0.756	8.651E-21	349	0.103	0.149	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:2w8gC	0.378	0.849	2.083E-19	217	0.111	0.258	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
15	PDB:7kuyE	0.507	0.732	5.009E-19	338	0.147	0.219	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:4hfcA	0.493	0.776	1.273E-18	311	0.103	0.167	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
17	PDB:4afhA	0.373	0.856	9.684E-18	213	0.109	0.258	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.455	0.715	2.212E-14	311	0.111	0.180	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.391	0.653	3.634E-11	288	0.101	0.177	6zgdA.pdb.gz
20	PDB:4wz9B	0.133	0.087	6.700E-3	887	0.046	0.026	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0X1KG79	0.0	533	507	0.550	0.548	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1
2	P04757	0.0	931	499	0.903	0.914	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1
3	P09481	0.0	854	496	0.800	0.815	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
4	P12389	0.0	526	511	0.550	0.544	ACHA2_RAT Neuronal acetylcholine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Chrna2 PE=2 SV=2
5	P32297	0.0	1041	505	1.000	1.000	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
6	P43143	0.0	637	493	0.602	0.617	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
7	Q15822	0.0	533	529	0.550	0.526	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
8	Q15825	0.0	665	494	0.634	0.648	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
9	Q1RLX8	0.0	541	520	0.570	0.554	Q1RLX8_DANRE Cholinergic receptor, nicotinic, alpha 2a (neuronal) OS=Danio rerio OX=7955 GN=zgc:136717 PE=2 SV=1
10	Q8R4G9	0.0	931	499	0.905	0.916	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
11	Q91X60	0.0	529	512	0.552	0.545	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
12	Q9R0W9	0.0	650	494	0.612	0.626	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
13	P09482	1.47e-163	479	622	0.473	0.384	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
14	O70174	2.48e-161	473	629	0.459	0.369	ACHA4_MOUSE Neuronal acetylcholine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Chrna4 PE=1 SV=2
15	P09483	1.83e-159	469	630	0.459	0.368	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
16	P43681	5.21e-159	467	627	0.453	0.365	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
17	Q0PJT8	2.80e-158	465	627	0.459	0.370	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
18	P26153	1.98e-157	457	470	0.471	0.506	ACHB4_CHICK Neuronal acetylcholine receptor subunit beta-4 (Fragment) OS=Gallus gallus OX=9031 GN=CHRNB4 PE=1 SV=1
19	P02711	6.07e-152	443	461	0.461	0.505	ACHA_TORMA Acetylcholine receptor subunit alpha OS=Torpedo marmorata OX=7788 GN=CHRNA1 PE=1 SV=1
20	P09484	1.67e-151	443	491	0.457	0.470	ACHB2_CHICK Neuronal acetylcholine receptor subunit beta-2 OS=Gallus gallus OX=9031 GN=CHRNB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17854 FtsK_alpha	3.8e+02	12.7	FtsK alpha domain
2	PF02931 Neur_chan_LBD	6.9e-72	252.9	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	2.2e-90	314.5	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315602

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357461	0.944	Neuronal acetylcholine receptor subunit beta-2
2	9606.ENSP00000261751	0.941	Neuronal acetylcholine receptor subunit beta-4
3	9606.ENSP00000407546	0.927	Neuronal acetylcholine receptor subunit alpha-7
4	9606.ENSP00000312663	0.908	Neuronal acetylcholine receptor subunit alpha-9
5	9606.ENSP00000359285	0.906	Neuronal acetylcholine receptor subunit alpha-4
6	9606.ENSP00000385026	0.905	Neuronal acetylcholine receptor subunit alpha-2
7	9606.ENSP00000299565	0.885	Neuronal acetylcholine receptor subunit alpha-5
8	9606.ENSP00000371067	0.814	Tyrosine-protein kinase JAK2
9	9606.ENSP00000044462	0.813	Proteasome subunit alpha type-4
10	9606.ENSP00000455459	0.801	Hydroxylysine kinase
11	9606.ENSP00000264344	0.739	Protein FAM13A
12	9606.ENSP00000304290	0.738	Acetylcholine receptor subunit beta
13	9606.ENSP00000258886	0.711	Iron-responsive element-binding protein 2
14	9606.ENSP00000246515	0.706	Secreted Ly-6/uPAR-related protein 1
15	9606.ENSP00000435954	0.700	Potassium voltage-gated channel subfamily V member 1
16	9606.ENSP00000269305	0.694	Cellular tumor antigen p53
17	9606.ENSP00000296575	0.694	Hedgehog-interacting protein
18	9606.ENSP00000301141	0.681	Cytochrome P450 2A6
19	9606.ENSP00000338345	0.676	Alpha-synuclein
20	9606.ENSP00000299847	0.661	CHRNA7-FAM7A fusion protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	1.000	acetylcholine-gated monoatomic cation-selective channel activity
GO:0042165	0.998	neurotransmitter binding
GO:0043169	0.998	cation binding
GO:0050997	0.996	quaternary ammonium group binding
GO:0005515	0.996	protein binding
GO:0004888	0.993	transmembrane signaling receptor activity
GO:0015464	0.972	acetylcholine receptor activity
GO:0042166	0.878	acetylcholine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0050896	0.998	response to stimulus
GO:0009987	0.994	cellular process
GO:0042391	0.993	regulation of membrane potential
GO:0035094	0.982	response to nicotine
GO:0007154	0.980	cell communication
GO:0023052	0.976	signaling
GO:0050789	0.964	regulation of biological process
GO:0051899	0.942	membrane depolarization
GO:0007267	0.941	cell-cell signaling
GO:0099536	0.933	synaptic signaling
GO:0050794	0.921	regulation of cellular process
GO:0032501	0.891	multicellular organismal process
GO:0007268	0.867	chemical synaptic transmission
GO:0030534	0.713	adult behavior
GO:0051716	0.622	cellular response to stimulus
GO:0007165	0.477	signal transduction
GO:0032502	0.347	developmental process
GO:0048856	0.344	anatomical structure development
GO:0051179	0.304	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098802	0.996	plasma membrane signaling receptor complex
GO:0034702	0.993	ion channel complex
GO:0005892	0.981	acetylcholine-gated channel complex
GO:0043226	0.961	organelle
GO:0043227	0.899	membrane-bounded organelle
GO:0005622	0.898	intracellular anatomical structure
GO:0043231	0.835	intracellular membrane-bounded organelle
GO:0031974	0.701	membrane-enclosed lumen
GO:0070013	0.687	intracellular organelle lumen
GO:0005737	0.634	cytoplasm
GO:0005634	0.513	nucleus
GO:0030054	0.333	cell junction
GO:0120025	0.305	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]