StarFunc result for job id P32322

User Input

>input (319 residues)
MSVGFIGAGQLAFALAKGFTAAGVLAAHKIMASSPDMDLATVSALRKMGVKLTPHNKETV
QHSDVLFLAVKPHIIPFILDEIGADIEDRHIVVSCAAGVTISSIEKKLSAFRPAPRVIRC
MTNTPVVVREGATVYATGTHAQVEDGRLMEQLLSSVGFCTEVEEDLIDAVTGLSGSGPAY
AFTALDALADGGVKMGLPRRLAVRLGAQALLGAAKMLLHSEQHPGQLKDNVSSPGGATIH
ALHVLESGGFRSLLINAVEASCIRTRELQSMADQEQVSPAAIKKTILDKVKLDSPAGTAL
SPSGHTKLLPRSLAPAGKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32322	1.000	1.000	3.685E-56	319	1.000	1.000	P32322.pdb.gz	P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2
2	AFDB:A0A0S2Z5U6	0.883	0.880	3.227E-51	320	0.846	0.844	A0A0S2Z5U6.pdb.gz	A0A0S2Z5U6_HUMAN Pyrroline-5-carboxylate reductase (Fragment) OS=Homo sapiens OX=9606 GN=PYCR2 PE=2 SV=1
3	AFDB:A0A140LG13	0.925	0.897	5.209E-48	329	0.787	0.763	A0A140LG13.pdb.gz
4	PDB:6xp1B	0.860	0.976	1.102E-46	281	0.862	0.979	6xp1B.pdb.gz	In crystallo screening for proline analog inhibitors of the proline cycle enzyme PYCR1.
5	PDB:6lhmD	0.799	0.926	1.246E-37	273	0.752	0.879	6lhmD.pdb.gz
6	AFDB:A0A087WTV6	0.544	0.687	1.215E-29	246	0.639	0.829	A0A087WTV6.pdb.gz	A0A087WTV6_HUMAN pyrroline-5-carboxylate reductase OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1
7	AFDB:A0A0A0MQS1	0.779	0.865	3.834E-29	286	0.373	0.416	A0A0A0MQS1.pdb.gz	A0A0A0MQS1_HUMAN Pyrroline-5-carboxylate reductase OS=Homo sapiens OX=9606 GN=PYCR3 PE=1 SV=1
8	AFDB:P54904	0.779	0.894	9.159E-28	276	0.367	0.424	P54904.pdb.gz	P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana OX=3702 GN=PROC1 PE=2 SV=1
9	AFDB:P22008	0.754	0.872	3.580E-26	273	0.310	0.363	P22008.pdb.gz	P5CR_PSEAE Pyrroline-5-carboxylate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=proC PE=1 SV=2
10	AFDB:Q57XN0	0.815	0.589	1.331E-25	444	0.298	0.214	Q57XN0.pdb.gz	Q57XN0_TRYB2 Pyrroline-5-carboxylate reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.470 PE=3 SV=1
11	AFDB:P0A9L8	0.770	0.905	2.300E-25	269	0.310	0.368	P0A9L8.pdb.gz	P5CR_ECOLI Pyrroline-5-carboxylate reductase OS=Escherichia coli (strain K12) OX=83333 GN=proC PE=1 SV=1
12	AFDB:P9WHU7	0.746	0.803	6.387E-21	295	0.285	0.308	P9WHU7.pdb.gz	P5CR_MYCTU Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=proC PE=1 SV=1
13	PDB:2plaA	0.437	0.410	2.346E-8	343	0.185	0.172	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
14	PDB:4ypoA	0.465	0.460	3.634E-8	325	0.138	0.135	4ypoA.pdb.gz	Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
15	PDB:6jx2B	0.511	0.500	5.630E-8	327	0.116	0.113	6jx2B.pdb.gz	Crystal Structure and Biochemical Characterization of Ketol-Acid Reductoisomerase fromCorynebacterium glutamicum.
16	PDB:3ckyA	0.437	0.466	8.721E-8	297	0.160	0.172	3ckyA.pdb.gz
17	PDB:1x0xA	0.434	0.399	1.876E-7	350	0.179	0.163	1x0xA.pdb.gz	Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)
18	PDB:3f3sA	0.421	0.430	2.211E-7	312	0.147	0.151	3f3sA.pdb.gz	The Crystal Structure of Human Lambda-Crystallin, CRYL1
19	PDB:2f1kA	0.450	0.507	3.617E-7	279	0.132	0.151	2f1kA.pdb.gz	Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction
20	PDB:3dojA	0.435	0.469	3.617E-7	292	0.113	0.123	3dojA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5U6	0.0	550	320	0.846	0.844	A0A0S2Z5U6_HUMAN Pyrroline-5-carboxylate reductase (Fragment) OS=Homo sapiens OX=9606 GN=PYCR2 PE=2 SV=1
2	F1RDD0	0.0	508	317	0.784	0.789	F1RDD0_DANRE Pyrroline-5-carboxylate reductase OS=Danio rerio OX=7955 GN=zgc:110655 PE=1 SV=2
3	P32322	0.0	641	319	1.000	1.000	P5CR1_HUMAN Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PYCR1 PE=1 SV=2
4	Q922W5	0.0	570	309	0.887	0.916	P5CR1_MOUSE Pyrroline-5-carboxylate reductase 1, mitochondrial OS=Mus musculus OX=10090 GN=Pycr1 PE=1 SV=1
5	Q96C36	0.0	550	320	0.846	0.844	P5CR2_HUMAN Pyrroline-5-carboxylate reductase 2 OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1
6	A0A087WTV6	2.80e-74	230	246	0.370	0.480	A0A087WTV6_HUMAN pyrroline-5-carboxylate reductase OS=Homo sapiens OX=9606 GN=PYCR2 PE=1 SV=1
7	Q53H96	9.41e-74	230	274	0.389	0.453	P5CR3_HUMAN Pyrroline-5-carboxylate reductase 3 OS=Homo sapiens OX=9606 GN=PYCR3 PE=1 SV=3
8	A0A0A0MQS1	2.00e-73	229	286	0.389	0.434	A0A0A0MQS1_HUMAN Pyrroline-5-carboxylate reductase OS=Homo sapiens OX=9606 GN=PYCR3 PE=1 SV=1
9	P54904	2.02e-69	219	276	0.367	0.424	P5CR1_ARATH Pyrroline-5-carboxylate reductase OS=Arabidopsis thaliana OX=3702 GN=PROC1 PE=2 SV=1
10	P0A9L8	3.22e-50	169	269	0.317	0.375	P5CR_ECOLI Pyrroline-5-carboxylate reductase OS=Escherichia coli (strain K12) OX=83333 GN=proC PE=1 SV=1
11	P22008	2.18e-49	167	273	0.332	0.388	P5CR_PSEAE Pyrroline-5-carboxylate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=proC PE=1 SV=2
12	Q57XN0	6.33e-42	152	444	0.298	0.214	Q57XN0_TRYB2 Pyrroline-5-carboxylate reductase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.22O10.470 PE=3 SV=1
13	Q9P7Y7	1.11e-34	129	282	0.248	0.280	P5CR_SCHPO Pyrroline-5-carboxylate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pro3 PE=3 SV=1
14	P32263	7.17e-30	117	286	0.226	0.252	P5CR_YEAST Pyrroline-5-carboxylate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRO3 PE=1 SV=1
15	P9WHU7	1.15e-28	114	295	0.279	0.302	P5CR_MYCTU Pyrroline-5-carboxylate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=proC PE=1 SV=1
16	Q08622	1.8	32.7	556	0.063	0.036	GEP3_YEAST Genetic interactor of prohibitins 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GEP3 PE=1 SV=1
17	G8BE40	2.8	32.0	248	0.053	0.069	G8BE40_CANPC Phosphoglycerate mutase OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_211810 PE=3 SV=1
18	Q60343	4.9	31.2	274	0.078	0.091	TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=trm4 PE=1 SV=1
19	Q556W1	5.7	31.2	346	0.056	0.052	OXDD_DICDI D-aspartate oxidase OS=Dictyostelium discoideum OX=44689 GN=ddo-1 PE=3 SV=1
20	B6HFX8	6.3	31.2	732	0.075	0.033	PCHDS_PENRW Conidiogenone synthase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=PchDS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02558 ApbA	88	14.2	Ketopantoate reductase PanE/ApbA
2	PF03807 F420_oxidored	1.3e-18	78.7	NADP oxidoreductase coenzyme F420-dependent
3	PF01210 NAD_Gly3P_dh_N	7.2	18.1	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
4	PF14748 P5CR_dimer	1.3e-34	130.0	Pyrroline-5-carboxylate reductase dimerisation
5	PF10727 Rossmann-like	15	16.9	Rossmann-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008954733.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003819509.1	0.960	Belongs to the pyrroline-5-carboxylate reductase family.
2	9597.XP_003814963.1	0.958	Belongs to the pyrroline-5-carboxylate reductase family.
3	9597.XP_003814482.1	0.953	Belongs to the aldehyde dehydrogenase family.
4	9597.XP_008948960.1	0.951	In the C-terminal section
5	9597.XP_003812747.1	0.919	Pipecolic acid and sarcosine oxidase
6	9597.XP_003846029.1	0.910	Leucine aminopeptidase 3
7	9597.XP_008964935.1	0.908	Proline dehydrogenase 1, mitochondrial
8	9597.XP_003816032.1	0.903	Prolyl 4-hydroxylase subunit alpha-1
9	9597.XP_003829358.1	0.903	Prolyl 4-hydroxylase subunit alpha 2
10	9597.XP_008967396.1	0.879	Probable proline dehydrogenase 2
11	9597.XP_003827865.1	0.806	Nudix hydrolase 5
12	9597.XP_008957366.1	0.663	Putative Notch ligand involved in the mediation of Notch signaling
13	9597.XP_003822177.1	0.639	Parkinsonism associated deglycase
14	9597.XP_008967612.1	0.616	Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family
15	9597.XP_008973723.1	0.595	PCF11 cleavage and polyadenylation factor subunit
16	9597.XP_003805490.1	0.571	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
17	9597.XP_003806473.1	0.570	Nuclear cap-binding protein subunit 2 isoform X1
18	9597.XP_003824689.1	0.567	RAB6-interacting golgin
19	9597.XP_003832934.1	0.557	Bardet-Biedl syndrome 10
20	9597.XP_008967501.1	0.552	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 322 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004735	1.000	pyrroline-5-carboxylate reductase activity
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:1901564	0.979	organonitrogen compound metabolic process
GO:1901576	0.972	organic substance biosynthetic process
GO:0044249	0.972	cellular biosynthetic process
GO:0044281	0.970	small molecule metabolic process
GO:0006560	0.963	proline metabolic process
GO:0009084	0.926	glutamine family amino acid biosynthetic process
GO:0050896	0.919	response to stimulus
GO:0062197	0.900	cellular response to chemical stress
GO:0006979	0.890	response to oxidative stress
GO:0034599	0.870	cellular response to oxidative stress
GO:0065007	0.549	biological regulation
GO:0050794	0.535	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.933	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14109	1.000	L-proline + NADP(+) = 1-pyrroline-5-carboxylate + 2 H(+) + NADPH
EC:1.5.1.2	1.000	pyrroline-5-carboxylate reductase.

[back to server]