StarFunc result for job id P32418

User Input

>input (973 residues)
MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGVI
LPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEKEITIKKPNG
ETTKTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHNFTAGDLGPSTIVGSAAFNMF
IIIALCVYVVPDGETRKIKHLRVFFVTAAWSIFAYTWLYIILSVISPGVVEVWEGLLTFF
FFPICVVFAWVADRRLLFYKYVYKRYRAGKQRGMIIEHEGDRPSSKTEIEMDGKVVNSHV
ENFLDGALVLEVDERDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKS
RAFYRIQATRLMTGAGNILKRHAADQARKAVSMHEVNTEVTENDPVSKIFFEQGTYQCLE
NCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGII
DDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIF
TFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQND
EIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPV
FRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAEMGRPILGEHTKLEVIIEESY
EFKSTVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHF
LTVFWKVLFAFVPPTEYWNGWACFIVSILMIGLLTAFIGDLASHFGCTIGLKDSVTAVVF
VALGTSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAANGEQF
KVSPGTLAFSVTLFTIFAFINVGVLLYRRRPEIGGELGGPRTAKLLTSCLFVLLWLLYIF
FSSLEAYCHIKGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286YBI0	0.801	0.833	0.000	933	0.739	0.771	A0A286YBI0.pdb.gz	A0A286YBI0_DANRE Sodium/calcium exchanger 1 isoform X2 OS=Danio rerio OX=7955 GN=ncx1 PE=1 SV=2
2	AFDB:A4UQV6	0.759	0.786	0.000	939	0.672	0.696	A4UQV6.pdb.gz	A4UQV6_DANRE Ncx4a OS=Danio rerio OX=7955 GN=slc8a4a PE=2 SV=1
3	AFDB:P32418	1.000	1.000	0.000	973	1.000	1.000	P32418.pdb.gz	NAC1_HUMAN Sodium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC8A1 PE=1 SV=3
4	AFDB:P48768	0.811	0.853	0.000	921	0.628	0.663	P48768.pdb.gz	NAC2_RAT Sodium/calcium exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc8a2 PE=1 SV=1
5	AFDB:Q32SG8	0.766	0.765	0.000	974	0.761	0.760	Q32SG8.pdb.gz	Q32SG8_DANRE Sodium calcium exchanger 1h OS=Danio rerio OX=7955 GN=ncx1h PE=1 SV=1
6	AFDB:S4R2P9	0.805	0.841	0.000	928	0.690	0.723	S4R2P9.pdb.gz	NAC3_MOUSE Sodium/calcium exchanger 3 OS=Mus musculus OX=10090 GN=Slc8a3 PE=1 SV=1
7	AFDB:A0A0B4K6E2	0.716	0.716	1.334E-88	973	0.454	0.454	A0A0B4K6E2.pdb.gz	A0A0B4K6E2_DROME Na/Ca-exchange protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
8	AFDB:A0A0B4K6R7	0.720	0.736	3.421E-88	950	0.451	0.462	A0A0B4K6R7.pdb.gz	A0A0B4K6R7_DROME Na/Ca-exchange protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
9	AFDB:Q9QZM6	0.346	0.289	2.378E-16	1181	0.160	0.132	Q9QZM6.pdb.gz	NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc24a1 PE=2 SV=1
10	AFDB:O60721	0.339	0.302	1.635E-15	1099	0.141	0.125	O60721.pdb.gz	NCKX1_HUMAN Sodium/potassium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC24A1 PE=1 SV=1
11	PDB:7sqcO0	0.093	0.080	1.469E-6	1140	0.034	0.029	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:1l9mB	0.098	0.125	8.069E-6	681	0.030	0.043	1l9mB.pdb.gz	Three-dimensional structure of the human transglutaminase 3 enzyme: binding of calcium ions changes structure for activation.
13	PDB:7tvzE	0.106	0.140	1.808E-5	665	0.015	0.023	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
14	PDB:7b0xC	0.097	0.373	2.475E-5	211	0.030	0.137	7b0xC.pdb.gz
15	PDB:4pygA	0.101	0.130	2.831E-5	685	0.016	0.023	4pygA.pdb.gz	Crystal structure of transglutaminase 2 with GTP complex and amino acid sequence evidence of evolution of GTP binding site.
16	PDB:1f13A	0.101	0.124	4.848E-5	722	0.030	0.040	1f13A.pdb.gz
17	PDB:3fcsA	0.096	0.102	5.546E-5	913	0.032	0.034	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
18	PDB:7u05B	0.092	0.107	8.303E-5	815	0.040	0.048	7u05B.pdb.gz
19	PDB:4nenA	0.083	0.079	9.081E-5	1063	0.030	0.027	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
20	PDB:4b0mM	0.099	0.393	1.243E-4	212	0.018	0.085	4b0mM.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K6A6	813	960	0.452	0.458	A0A0B4K6A6_DROME Na/Ca-exchange protein, isoform F OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
2	A0A0B4K6E2	815	973	0.454	0.454	A0A0B4K6E2_DROME Na/Ca-exchange protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
3	A0A0B4K6R7	808	950	0.452	0.463	A0A0B4K6R7_DROME Na/Ca-exchange protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
4	A0A0B4K790	811	963	0.454	0.459	A0A0B4K790_DROME Na/Ca-exchange protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
5	A0A0B4LHD7	807	955	0.453	0.462	A0A0B4LHD7_DROME Na/Ca-exchange protein, isoform H OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=1
6	A0A286YBI0	1444	933	0.742	0.774	A0A286YBI0_DANRE Sodium/calcium exchanger 1 isoform X2 OS=Danio rerio OX=7955 GN=ncx1 PE=1 SV=2
7	A4UQV6	1281	939	0.673	0.698	A4UQV6_DANRE Ncx4a OS=Danio rerio OX=7955 GN=slc8a4a PE=2 SV=1
8	F1R4F4	1495	969	0.762	0.765	F1R4F4_DANRE Sodium/calcium exchanger 1 isoform X3 OS=Danio rerio OX=7955 GN=ncx1 PE=1 SV=1
9	O18367	803	950	0.450	0.461	O18367_DROME CALX OS=Drosophila melanogaster OX=7227 GN=Calx PE=2 SV=1
10	O35157	1798	940	0.898	0.930	O35157_MOUSE Sodium/calcium exchanger 1 OS=Mus musculus OX=10090 GN=Slc8a1 PE=1 SV=1
11	P23685	1953	970	0.976	0.979	NAC1_CANLF Sodium/calcium exchanger 1 OS=Canis lupus familiaris OX=9615 GN=SLC8A1 PE=1 SV=1
12	P32418	2000	973	1.000	1.000	NAC1_HUMAN Sodium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC8A1 PE=1 SV=3
13	P48765	1949	970	0.970	0.973	NAC1_BOVIN Sodium/calcium exchanger 1 OS=Bos taurus OX=9913 GN=SLC8A1 PE=1 SV=1
14	P48766	1954	970	0.974	0.977	NAC1_CAVPO Sodium/calcium exchanger 1 OS=Cavia porcellus OX=10141 GN=SLC8A1 PE=2 SV=1
15	P48768	1212	921	0.624	0.659	NAC2_RAT Sodium/calcium exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc8a2 PE=1 SV=1
16	P57103	1329	927	0.693	0.727	NAC3_HUMAN Sodium/calcium exchanger 3 OS=Homo sapiens OX=9606 GN=SLC8A3 PE=1 SV=2
17	P70414	1874	970	0.945	0.947	NAC1_MOUSE Sodium/calcium exchanger 1 OS=Mus musculus OX=10090 GN=Slc8a1 PE=1 SV=1
18	P70549	1327	927	0.691	0.725	NAC3_RAT Sodium/calcium exchanger 3 OS=Rattus norvegicus OX=10116 GN=Slc8a3 PE=1 SV=1
19	Q01728	1878	971	0.950	0.952	NAC1_RAT Sodium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc8a1 PE=1 SV=3
20	Q24413	805	950	0.454	0.465	Q24413_DROME Na/Ca exchange protein OS=Drosophila melanogaster OX=7227 GN=Calx PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03160 Calx-beta	4.6e-61	214.6	Calx-beta domain
2	PF08278 DnaG_DnaB_bind	1.7e+02	14.3	DNA primase DnaG DnaB-binding
3	PF01699 Na_Ca_ex	4.5e-60	213.4	Sodium/calcium exchanger protein
4	PF16494 Na_Ca_ex_C	2.2e-50	182.0	C-terminal extension of sodium/calcium exchanger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384763

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363092	0.845	cGMP-dependent protein kinase 1
2	9606.ENSP00000368966	0.835	Short transient receptor potential channel 3
3	9606.ENSP00000236877	0.812	Sodium/calcium exchanger 2
4	9606.ENSP00000359719	0.812	cAMP-dependent protein kinase catalytic subunit beta
5	9606.ENSP00000264399	0.811	cGMP-dependent protein kinase 2
6	9606.ENSP00000309591	0.807	cAMP-dependent protein kinase catalytic subunit alpha
7	9606.ENSP00000366488	0.807	cAMP-dependent protein kinase catalytic subunit gamma
8	9606.ENSP00000370669	0.804	Sodium/calcium exchanger 3
9	9606.ENSP00000440045	0.749	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
10	9606.ENSP00000355533	0.745	Ryanodine receptor 2
11	9606.ENSP00000350132	0.730	Cardiac phospholamban
12	9606.ENSP00000392043	0.729	Plasma membrane calcium-transporting ATPase 1
13	9606.ENSP00000265310	0.722	Transient receptor potential cation channel subfamily V member 5
14	9606.ENSP00000369547	0.710	S100 calcium binding protein G
15	9606.ENSP00000262352	0.708	Excitatory amino acid transporter 3
16	9606.ENSP00000354490	0.690	Sodium/potassium-transporting ATPase subunit alpha-2
17	9606.ENSP00000352358	0.681	Transient receptor potential cation channel subfamily V member 6
18	9606.ENSP00000280979	0.680	A-kinase anchor protein 6
19	9606.ENSP00000261892	0.676	Sodium/potassium/calcium exchanger 1
20	9606.ENSP00000341940	0.668	Caveolin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005432	1.000	calcium:sodium antiporter activity
GO:0005488	0.999	binding
GO:0005515	0.993	protein binding
GO:0043167	0.567	ion binding
GO:0043169	0.442	cation binding
GO:0046872	0.431	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0006810	0.995	transport
GO:0030001	0.991	metal ion transport
GO:0009987	0.989	cellular process
GO:0051239	0.986	regulation of multicellular organismal process
GO:0006816	0.984	calcium ion transport
GO:0044057	0.979	regulation of system process
GO:0008016	0.961	regulation of heart contraction
GO:0098771	0.957	inorganic ion homeostasis
GO:0050801	0.952	monoatomic ion homeostasis
GO:0055080	0.922	monoatomic cation homeostasis
GO:0098662	0.911	inorganic cation transmembrane transport
GO:0098655	0.911	monoatomic cation transmembrane transport
GO:0070588	0.881	calcium ion transmembrane transport
GO:0050794	0.809	regulation of cellular process
GO:0032501	0.803	multicellular organismal process
GO:0050896	0.719	response to stimulus
GO:0019725	0.717	cellular homeostasis
GO:0003008	0.665	system process
GO:0048856	0.564	anatomical structure development
GO:0007154	0.499	cell communication
GO:0065008	0.491	regulation of biological quality
GO:0055074	0.469	calcium ion homeostasis
GO:0006873	0.447	intracellular monoatomic ion homeostasis
GO:0030003	0.429	intracellular monoatomic cation homeostasis
GO:0006874	0.416	intracellular calcium ion homeostasis
GO:0051716	0.415	cellular response to stimulus
GO:0042221	0.385	response to chemical
GO:0023052	0.336	signaling
GO:0048518	0.330	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.987	organelle
GO:0005622	0.985	intracellular anatomical structure
GO:0043229	0.958	intracellular organelle
GO:0043227	0.946	membrane-bounded organelle
GO:0005737	0.943	cytoplasm
GO:0043231	0.886	intracellular membrane-bounded organelle
GO:0030054	0.879	cell junction
GO:0045202	0.764	synapse
GO:0042383	0.698	sarcolemma
GO:0030315	0.673	T-tubule
GO:0043228	0.617	non-membrane-bounded organelle
GO:0120025	0.578	plasma membrane bounded cell projection
GO:0098590	0.557	plasma membrane region
GO:0043232	0.538	intracellular non-membrane-bounded organelle
GO:0043005	0.497	neuron projection
GO:0005634	0.423	nucleus
GO:0070013	0.420	intracellular organelle lumen
GO:0032991	0.371	protein-containing complex
GO:0031981	0.357	nuclear lumen
GO:0070161	0.337	anchoring junction
GO:0098794	0.337	postsynapse
GO:0030424	0.335	axon
GO:0005911	0.305	cell-cell junction
GO:0005654	0.300	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29255	1.000	Ca(2+)(in) + Na(+)(out) = Ca(2+)(out) + Na(+)(in)

[back to server]