StarFunc result for job id P32456

User Input

>input (591 residues)
MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAG
KKNGFSLGSTVKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAI
LLSSTFVYNSMGTINQQAMDQLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTL
RDFTLELEVDGEPITADDYLELSLKLRKGTDKKSKSFNDPRLCIRKFFPKRKCFVFDWPA
PKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTLSGGIPVNGPRLESLVLTYVN
AISSGDLPCMENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQELLDLHRDSER
EAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV
KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSL
SEKEKAIEVERIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQL
MAEQEKTLALKLQEQERLLKEGFENESKRLQKDIWDIQMRSKSLEPICNIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32456	1.000	1.000	1.345E-96	591	1.000	1.000	P32456.pdb.gz	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
2	AFDB:P32455	0.988	0.986	1.177E-81	592	0.760	0.758	P32455.pdb.gz	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
3	AFDB:Q9H0R5	0.946	0.940	1.829E-78	595	0.748	0.743	Q9H0R5.pdb.gz	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3
4	PDB:7m1sA	0.930	0.952	2.030E-78	577	0.971	0.995	7m1sA.pdb.gz
5	AFDB:B2XWS1	0.989	0.990	7.144E-78	590	0.702	0.703	B2XWS1.pdb.gz	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
6	AFDB:Q01514	0.979	0.982	1.609E-76	589	0.714	0.716	Q01514.pdb.gz	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
7	AFDB:Q9Z0E6	0.977	0.980	6.599E-76	589	0.712	0.715	Q9Z0E6.pdb.gz	GBP2_MOUSE Guanylate-binding protein 2 OS=Mus musculus OX=10090 GN=Gbp2 PE=1 SV=1
8	AFDB:Q96PP9	0.969	0.895	1.271E-67	640	0.535	0.494	Q96PP9.pdb.gz	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
9	PDB:6k1zA	0.894	0.970	2.747E-66	544	0.707	0.768	6k1zA.pdb.gz	Structural mechanism for guanylate-binding proteins (GBPs) targeting by the Shigella E3 ligase IpaH9.8.
10	AFDB:Q6ZN66	0.947	0.886	5.390E-66	633	0.523	0.488	Q6ZN66.pdb.gz	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
11	AFDB:Q8N8V2	0.955	0.887	7.956E-66	638	0.553	0.513	Q8N8V2.pdb.gz	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
12	AFDB:Q91Z40	0.970	0.899	1.049E-64	638	0.535	0.495	Q91Z40.pdb.gz	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
13	PDB:6lojB	0.924	0.955	1.485E-64	571	0.743	0.769	6lojB.pdb.gz	Substrate-binding destabilizes the hydrophobic cluster to relieve the autoinhibition of bacterial ubiquitin ligase IpaH9.8.
14	PDB:3x1dA	0.425	0.619	9.254E-12	381	0.142	0.220	3x1dA.pdb.gz	Comparison of human and Drosophila atlastin GTPases
15	PDB:7pw4C	0.299	0.532	1.041E-6	310	0.080	0.152	7pw4C.pdb.gz	Cryo-EM reconstructions of inhibitor-bound SMG1 kinase reveal an autoinhibitory state dependent on SMG8.
16	PDB:3zjcE	0.235	0.421	9.302E-6	286	0.090	0.185	3zjcE.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
17	PDB:3zjcF	0.209	0.415	2.027E-5	252	0.081	0.190	3zjcF.pdb.gz	Structural Insights Into the Mechanism of Gtpase Activation in the Gimap Family.
18	PDB:1zbdA	0.164	0.442	1.725E-4	177	0.052	0.175	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
19	PDB:1tq6A	0.194	0.268	2.095E-4	402	0.085	0.124	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
20	PDB:1uptG	0.194	0.541	2.200E-4	170	0.049	0.171	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JDV3	592	611	0.496	0.480	GBP6_MOUSE Guanylate-binding protein 6 OS=Mus musculus OX=10090 GN=Gbp6 PE=2 SV=2
2	B2XWS1	875	590	0.701	0.702	B2XWS1_PIG Guanylate binding protein 1 OS=Sus scrofa OX=9823 GN=GBP1 PE=1 SV=1
3	L7N1X8	596	611	0.497	0.481	L7N1X8_MOUSE Predicted gene 43302 OS=Mus musculus OX=10090 GN=Gm43302 PE=3 SV=2
4	P32455	952	592	0.758	0.757	GBP1_HUMAN Guanylate-binding protein 1 OS=Homo sapiens OX=9606 GN=GBP1 PE=1 SV=2
5	P32456	1222	591	1.000	1.000	GBP2_HUMAN Guanylate-binding protein 2 OS=Homo sapiens OX=9606 GN=GBP2 PE=1 SV=3
6	Q000W5	584	611	0.489	0.473	Q000W5_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
7	Q01514	854	589	0.717	0.720	GBP1_MOUSE Guanylate-binding protein 1 OS=Mus musculus OX=10090 GN=Gbp1 PE=1 SV=1
8	Q29RG2	582	611	0.489	0.473	Q29RG2_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
9	Q2M1J9	580	611	0.487	0.471	Q2M1J9_MOUSE Guanylate-binding protein 10 OS=Mus musculus OX=10090 GN=Gbp10 PE=2 SV=1
10	Q5DTF3	526	606	0.430	0.419	Q5DTF3_MOUSE MKIAA4245 protein (Fragment) OS=Mus musculus OX=10090 GN=Gbp4 PE=2 SV=1
11	Q61107	645	620	0.533	0.508	GBP3_MOUSE Guanylate-binding protein 3 OS=Mus musculus OX=10090 GN=Gbp3 PE=1 SV=1
12	Q6PG83	582	619	0.487	0.465	Q6PG83_MOUSE cDNA sequence BC057170 OS=Mus musculus OX=10090 GN=Gbp9 PE=2 SV=1
13	Q6ZN66	637	633	0.521	0.487	GBP6_HUMAN Guanylate-binding protein 6 OS=Homo sapiens OX=9606 GN=GBP6 PE=1 SV=1
14	Q8BTS3	582	619	0.487	0.465	Q8BTS3_MOUSE Guanylate-binding protein 9 OS=Mus musculus OX=10090 GN=Gbp9 PE=1 SV=1
15	Q8CFB4	669	590	0.555	0.556	GBP5_MOUSE Guanylate-binding protein 5 OS=Mus musculus OX=10090 GN=Gbp5 PE=1 SV=2
16	Q8N8V2	635	638	0.552	0.511	GBP7_HUMAN Guanylate-binding protein 7 OS=Homo sapiens OX=9606 GN=GBP7 PE=1 SV=2
17	Q91Z40	660	638	0.536	0.497	GBP7_MOUSE Guanylate-binding protein 7 OS=Mus musculus OX=10090 GN=Gbp7 PE=1 SV=2
18	Q96PP8	749	586	0.611	0.616	GBP5_HUMAN Guanylate-binding protein 5 OS=Homo sapiens OX=9606 GN=GBP5 PE=1 SV=1
19	Q96PP9	638	640	0.533	0.492	GBP4_HUMAN Guanylate-binding protein 4 OS=Homo sapiens OX=9606 GN=GBP4 PE=1 SV=2
20	Q9H0R5	925	595	0.746	0.741	GBP3_HUMAN Guanylate-binding protein 3 OS=Homo sapiens OX=9606 GN=GBP3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01591 6PF2K	2.9e+02	12.2	6-phosphofructo-2-kinase
2	PF02263 GBP	1.3e-122	419.7	Guanylate-binding protein, N-terminal domain
3	PF02841 GBP_C	2.1e-124	426.4	Guanylate-binding protein, C-terminal domain
4	PF01926 MMR_HSR1	14	17.2	50S ribosome-binding GTPase
5	PF05879 RHD3_GTPase	0.025	25.5	Root hair defective 3 GTP-binding protein (RHD3) GTPase domain
6	PF05020 zf-NPL4	1.6e+02	13.8	NPL4 family, putative zinc binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354394	0.977	Signal transducer and activator of transcription 1-alpha/beta
2	9606.ENSP00000245414	0.973	Interferon regulatory factor 1
3	9606.ENSP00000360891	0.964	Interferon-induced protein with tetratricopeptide repeats 2
4	9606.ENSP00000380697	0.963	Interferon regulatory factor 7
5	9606.ENSP00000381601	0.961	Interferon-induced GTP-binding protein Mx1
6	9606.ENSP00000360869	0.960	Interferon-induced protein with tetratricopeptide repeats 1
7	9606.ENSP00000360883	0.959	Interferon-induced protein with tetratricopeptide repeats 3
8	9606.ENSP00000342278	0.957	2'-5'-oligoadenylate synthase 2
9	9606.ENSP00000257570	0.956	2'-5'-oligoadenylate synthase-like protein
10	9606.ENSP00000364016	0.955	Proteasome subunit beta type-8
11	9606.ENSP00000333657	0.953	Interferon-induced GTP-binding protein Mx2
12	9606.ENSP00000368699	0.953	Ubiquitin-like protein ISG15
13	9606.ENSP00000371471	0.953	Radical S-adenosyl methionine domain-containing protein 2
14	9606.ENSP00000380073	0.953	Interferon regulatory factor 9
15	9606.ENSP00000388001	0.951	2'-5'-oligoadenylate synthase 1
16	9606.ENSP00000395590	0.951	Interferon-induced 35 kDa protein
17	9606.ENSP00000315768	0.950	Signal transducer and activator of transcription 2
18	9606.ENSP00000306565	0.949	Interferon-stimulated gene 20 kDa protein
19	9606.ENSP00000382707	0.946	Interferon-induced transmembrane protein 3
20	9606.ENSP00000268638	0.943	Interferon regulatory factor 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:1901363	0.993	heterocyclic compound binding
GO:0097159	0.993	organic cyclic compound binding
GO:0043167	0.975	ion binding
GO:0043168	0.972	anion binding
GO:0032561	0.967	guanyl ribonucleotide binding
GO:0035639	0.890	purine ribonucleoside triphosphate binding
GO:0003824	0.889	catalytic activity
GO:0005525	0.864	GTP binding
GO:0016787	0.839	hydrolase activity
GO:0003924	0.774	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006950	0.998	response to stress
GO:0044419	0.997	biological process involved in interspecies interaction between organisms
GO:0051716	0.997	cellular response to stimulus
GO:0034097	0.996	response to cytokine
GO:0002376	0.992	immune system process
GO:0098542	0.990	defense response to other organism
GO:0071345	0.990	cellular response to cytokine stimulus
GO:0006955	0.979	immune response
GO:0071346	0.970	cellular response to type II interferon
GO:0050789	0.542	regulation of biological process
GO:0050794	0.462	regulation of cellular process
GO:0048518	0.390	positive regulation of biological process
GO:0060255	0.386	regulation of macromolecule metabolic process
GO:0048519	0.341	negative regulation of biological process
GO:0009617	0.328	response to bacterium
GO:0010468	0.316	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.990	endomembrane system
GO:0005829	0.975	cytosol
GO:0005576	0.967	extracellular region
GO:0031974	0.942	membrane-enclosed lumen
GO:0043233	0.929	organelle lumen
GO:0005634	0.914	nucleus
GO:0070013	0.907	intracellular organelle lumen
GO:0016020	0.886	membrane
GO:0031981	0.830	nuclear lumen
GO:0031982	0.808	vesicle
GO:0031410	0.684	cytoplasmic vesicle
GO:0005654	0.672	nucleoplasm
GO:0065010	0.470	extracellular membrane-bounded organelle
GO:0005794	0.404	Golgi apparatus
GO:0071944	0.365	cell periphery
GO:0005886	0.348	plasma membrane
GO:0031090	0.330	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.839	Hydrolases.
RHEA:19669	0.774	GTP + H2O = GDP + H(+) + phosphate

[back to server]