StarFunc result for job id P32780

User Input

>input (548 residues)
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384MTQ8	0.969	0.969	1.721E-83	548	1.000	1.000	A0A384MTQ8.pdb.gz	A0A384MTQ8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:6o9l1	0.462	0.463	1.771E-50	546	0.995	0.998	6o9l1.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
3	AFDB:Q960E8	0.651	0.612	1.004E-49	585	0.469	0.439	Q960E8.pdb.gz	TF2H1_DROME General transcription factor IIH subunit 1 OS=Drosophila melanogaster OX=7227 GN=Tfb1 PE=2 SV=1
4	PDB:7egb1	0.556	0.719	4.692E-37	405	0.732	0.990	7egb1.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
5	PDB:6nmiC	0.641	0.845	1.696E-27	408	0.449	0.603	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
6	PDB:7nvr1	0.432	0.843	1.488E-20	265	0.478	0.989	7nvr1.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
7	PDB:7o4i1	0.534	0.555	8.097E-19	522	0.197	0.207	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
8	AFDB:P32776	0.486	0.423	5.994E-18	642	0.208	0.178	P32776.pdb.gz	TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB1 PE=1 SV=1
9	PDB:7lbmY	0.287	0.663	3.375E-17	218	0.338	0.849	7lbmY.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
10	AFDB:O13745	0.433	0.443	7.737E-17	533	0.197	0.203	O13745.pdb.gz	TFB1_SCHPO General transcription and DNA repair factor IIH subunit tfb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb1 PE=1 SV=2
11	PDB:7ad8I	0.214	0.473	1.837E-15	206	0.372	0.990	7ad8I.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:5oqj1	0.375	0.410	1.223E-12	491	0.168	0.187	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
13	PDB:7k041	0.418	0.459	3.367E-12	487	0.157	0.177	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
14	PDB:3pvuA	0.150	0.136	6.928E-5	609	0.031	0.028	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	AFDB:P38261	0.155	0.120	1.767E-4	753	0.097	0.070	P38261.pdb.gz	EXO84_YEAST Exocyst complex component EXO84 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EXO84 PE=1 SV=1
16	AFDB:O43048	0.172	0.117	2.186E-4	834	0.069	0.046	O43048.pdb.gz	YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC215.01 PE=3 SV=4
17	AFDB:Q5SQN1	0.154	0.180	2.854E-4	464	0.089	0.106	Q5SQN1.pdb.gz	SNP47_HUMAN Synaptosomal-associated protein 47 OS=Homo sapiens OX=9606 GN=SNAP47 PE=1 SV=3
18	AFDB:Q54G78	0.149	0.155	4.862E-4	527	0.040	0.042	Q54G78.pdb.gz	SSRP1_DICDI FACT complex subunit SSRP1 OS=Dictyostelium discoideum OX=44689 GN=ssrp1 PE=3 SV=1
19	AFDB:O08969	0.150	0.501	9.217E-4	144	0.036	0.139	O08969.pdb.gz	PHLA2_MOUSE Pleckstrin homology-like domain family A member 2 OS=Mus musculus OX=10090 GN=Phlda2 PE=1 SV=1
20	AFDB:Q53GA4	0.163	0.505	9.721E-4	152	0.038	0.138	Q53GA4.pdb.gz	PHLA2_HUMAN Pleckstrin homology-like domain family A member 2 OS=Homo sapiens OX=9606 GN=PHLDA2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWQ0	0.0	1059	524	0.923	0.966	A0A0G2JWQ0_RAT General transcription factor IIH subunit 1 OS=Rattus norvegicus OX=10116 GN=Gtf2h1 PE=1 SV=2
2	A0A384MTQ8	0.0	1148	548	1.000	1.000	A0A384MTQ8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	A0A8I6AJ08	0.0	1004	500	0.874	0.958	A0A8I6AJ08_RAT General transcription factor IIH subunit 1 OS=Rattus norvegicus OX=10116 GN=Gtf2h1 PE=1 SV=1
4	D3ZYG3	0.0	1019	516	0.912	0.969	D3ZYG3_RAT General transcription factor IIH subunit 1 OS=Rattus norvegicus OX=10116 GN=Gtf2h1 PE=3 SV=1
5	P32780	0.0	1148	548	1.000	1.000	TF2H1_HUMAN General transcription factor IIH subunit 1 OS=Homo sapiens OX=9606 GN=GTF2H1 PE=1 SV=1
6	Q9DBA9	0.0	1115	547	0.971	0.973	TF2H1_MOUSE General transcription factor IIH subunit 1 OS=Mus musculus OX=10090 GN=Gtf2h1 PE=1 SV=2
7	Q960E8	6.01e-176	511	585	0.485	0.455	TF2H1_DROME General transcription factor IIH subunit 1 OS=Drosophila melanogaster OX=7227 GN=Tfb1 PE=2 SV=1
8	P32776	1.15e-13	76.3	642	0.080	0.069	TFB1_YEAST General transcription and DNA repair factor IIH subunit TFB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFB1 PE=1 SV=1
9	O13745	1.01e-12	72.8	533	0.199	0.205	TFB1_SCHPO General transcription and DNA repair factor IIH subunit tfb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tfb1 PE=1 SV=2
10	I1ZHA5	0.89	34.7	603	0.049	0.045	CAD_CHAFM Sesquiterpene synthase Cad OS=Chamaecyparis formosensis OX=187461 GN=CAD PE=1 SV=1
11	Q9BX69	2.0	33.9	1037	0.047	0.025	CARD6_HUMAN Caspase recruitment domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CARD6 PE=1 SV=2
12	A0A1D8PQ69	2.6	33.5	693	0.051	0.040	A0A1D8PQ69_CANAL CCZ1/INTU/HSP4 first Longin domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CCZ1 PE=4 SV=1
13	Q9H9S0	3.6	32.3	305	0.038	0.069	NANOG_HUMAN Homeobox protein NANOG OS=Homo sapiens OX=9606 GN=NANOG PE=1 SV=2
14	A0A0D9SG05	3.8	32.3	289	0.038	0.073	A0A0D9SG05_HUMAN Nanog homeobox retrogene P8 OS=Homo sapiens OX=9606 GN=NANOGP8 PE=1 SV=1
15	Q6NSW7	3.8	32.3	305	0.038	0.069	NANP8_HUMAN Homeobox protein NANOGP8 OS=Homo sapiens OX=9606 GN=NANOGP8 PE=2 SV=2
16	Q03014	8.1	31.2	270	0.084	0.170	HHEX_HUMAN Hematopoietically-expressed homeobox protein HHEX OS=Homo sapiens OX=9606 GN=HHEX PE=1 SV=1
17	Q5JXX1	9.4	30.4	158	0.038	0.133	Q5JXX1_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03909 BSD	1.3e-19	81.2	BSD domain
2	PF08567 PH_TFIIH	8.3e-20	82.3	TFIIH p62 subunit, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265963

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000256897	0.999	Cyclin-H
3	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
4	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
5	9606.ENSP00000283875	0.999	General transcription factor IIE subunit 1
6	9606.ENSP00000285398	0.999	TFIIH basal transcription factor complex helicase XPB subunit
7	9606.ENSP00000328901	0.999	General transcription factor IIH subunit 2
8	9606.ENSP00000375809	0.999	TFIIH basal transcription factor complex helicase XPD subunit
9	9606.ENSP00000422907	0.999	General transcription factor IIH subunit 2-like protein
10	9606.ENSP00000445162	0.999	General transcription factor IIH subunit 3
11	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
12	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
13	9606.ENSP00000285021	0.996	DNA repair protein complementing XP-C cells
14	9606.ENSP00000348168	0.996	Transcription initiation factor IIE subunit beta
15	9606.ENSP00000347978	0.988	DNA repair protein complementing XP-G cells
16	9606.ENSP00000480158	0.986	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000428426	0.980	Transcription elongation factor A protein 1
18	9606.ENSP00000377969	0.979	General transcription factor IIF subunit 1
19	9606.ENSP00000375942	0.972	TATA-box-binding protein
20	9606.ENSP00000412698	0.971	MMS19 nucleotide excision repair protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0008134	0.933	transcription factor binding
GO:0140297	0.919	DNA-binding transcription factor binding
GO:0061629	0.913	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0046966	0.892	nuclear thyroid hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090304	0.995	nucleic acid metabolic process
GO:0006366	0.992	transcription by RNA polymerase II
GO:0065007	0.757	biological regulation
GO:0050789	0.753	regulation of biological process
GO:0050794	0.740	regulation of cellular process
GO:0050896	0.696	response to stimulus
GO:0019222	0.586	regulation of metabolic process
GO:0051716	0.562	cellular response to stimulus
GO:0031323	0.560	regulation of cellular metabolic process
GO:0080090	0.556	regulation of primary metabolic process
GO:0051171	0.550	regulation of nitrogen compound metabolic process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0010468	0.332	regulation of gene expression
GO:0019219	0.323	regulation of nucleobase-containing compound metabolic process
GO:0044260	0.307	cellular macromolecule metabolic process
GO:0010556	0.307	regulation of macromolecule biosynthetic process
GO:0031326	0.307	regulation of cellular biosynthetic process
GO:0048522	0.305	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0061695	0.997	transferase complex, transferring phosphorus-containing groups
GO:0140513	0.997	nuclear protein-containing complex
GO:0016591	0.988	RNA polymerase II, holoenzyme
GO:0090575	0.987	RNA polymerase II transcription regulator complex
GO:1902554	0.952	serine/threonine protein kinase complex
GO:0005675	0.940	transcription factor TFIIH holo complex
GO:0005737	0.498	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]