StarFunc result for job id P32926

User Input

>input (999 residues)
MMGLFPRTTGALAIFVVVILVHGELRIETKGQYDEEEMTMQQAKRRQKREWVKFAKPCRE
GEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREET
PSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILN
ATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGA
DKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDN
WLAVYFFTSGNEGNWFEIQTDPRTNEGILKVVKALDYEQLQSVKLSIAVKNKAEFHQSVI
SRYRVQSTPVTIQVINVREGIAFRPASKTFTVQKGISSKKLVDYILGTYQAIDEDTNKAA
SNVKYVMGRNDGGYLMIDSKTAEIKFVKNMNRDSTFIVNKTITAEVLAIDEYTGKTSTGT
VYVRVPDFNDNCPTAVLEKDAVCSSSPSVVVSARTLNNRYTGPYTFALEDQPVKLPAVWS
ITTLNATSALLRAQEQIPPGVYHISLVLTDSQNNRCEMPRSLTLEVCQCDNRGICGTSYP
TTSPGTRYGRPHSGRLGPAAIGLLLLGLLLLLLAPLLLLTCDCGAGSTGGVTGGFIPVPD
GSEGTIHQWGIEGAHPEDKEITNICVPPVTANGADFMESSEVCTNTYARGTAVEGTSGME
MTTKLGAATESGGAAGFATGTVSGAASGFGAATGVGICSSGQSGTMRTRHSTGGTNKDYA
DGAISMNFLDSYFSQKAFACAEEDDGQEANDCLLIYDNEGADATGSPVGSVGCCSFIADD
LDDSFLDSLGPKFKKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQT
LSGSQGASALSTSGSVQPAVSIPDPLQHGNYLVTETYSASGSLVQPSTAGFDPLLTQNVI
VTERVICPISSVPGNLAGPTQLRGSHTMLCTEDPCSRLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O35902	0.617	0.620	0.000	993	0.729	0.733	O35902.pdb.gz	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
2	AFDB:P32926	1.000	1.000	0.000	999	1.000	1.000	P32926.pdb.gz	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
3	AFDB:Q7TMD7	0.533	0.513	0.000	1041	0.473	0.454	Q7TMD7.pdb.gz	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
4	AFDB:Q86SJ6	0.518	0.500	0.000	1040	0.484	0.465	Q86SJ6.pdb.gz	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
5	AFDB:F1LYX9	0.450	0.402	5.401E-88	1128	0.414	0.367	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
6	AFDB:Q03763	0.461	0.442	7.200E-83	1043	0.416	0.399	Q03763.pdb.gz	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
7	AFDB:D3ZM39	0.440	0.417	2.136E-82	1060	0.407	0.384	D3ZM39.pdb.gz	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
8	AFDB:Q7TSF1	0.421	0.398	2.960E-82	1060	0.415	0.392	Q7TSF1.pdb.gz	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
9	AFDB:Q02413	0.431	0.412	1.986E-81	1049	0.394	0.376	Q02413.pdb.gz	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
10	AFDB:Q7TSF0	0.433	0.470	2.606E-81	911	0.408	0.448	Q7TSF0.pdb.gz	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
11	PDB:6velC	0.201	0.926	5.231E-23	209	0.079	0.378	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:7sqcO0	0.128	0.117	1.019E-14	1140	0.062	0.054	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
13	PDB:4aq1A	0.111	0.140	2.101E-12	721	0.069	0.096	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.133	0.176	2.962E-10	692	0.062	0.090	5oj2B.pdb.gz
15	PDB:1e07A	0.116	0.158	7.882E-10	642	0.057	0.089	1e07A.pdb.gz
16	PDB:4rtdA	0.080	0.073	4.915E-8	1122	0.062	0.055	4rtdA.pdb.gz
17	PDB:6dldD	0.115	0.284	1.111E-7	269	0.050	0.186	6dldD.pdb.gz
18	PDB:7q5zA	0.079	0.065	1.511E-6	1344	0.047	0.035	7q5zA.pdb.gz
19	PDB:5a42A	0.078	0.056	2.749E-6	1597	0.063	0.039	5a42A.pdb.gz
20	PDB:7sqcO1	0.124	0.166	2.749E-6	673	0.034	0.051	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AG90	0.0	618	1131	0.414	0.366	A0A8I6AG90_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=1
2	F1LYX9	0.0	624	1128	0.414	0.367	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
3	O35902	0.0	1425	993	0.731	0.735	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
4	O55111	0.0	608	1122	0.396	0.353	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
5	P32926	0.0	2063	999	1.000	1.000	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
6	Q02413	0.0	559	1049	0.266	0.254	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
7	Q14126	0.0	604	1118	0.388	0.347	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
8	Q6W3B0	0.0	922	1040	0.495	0.476	DSG4_RAT Desmoglein-4 OS=Rattus norvegicus OX=10116 GN=Dsg4 PE=1 SV=1
9	Q7TMD7	0.0	936	1041	0.492	0.473	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
10	Q86SJ6	0.0	931	1040	0.504	0.484	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
11	Q03763	3.83e-179	550	1043	0.266	0.255	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
12	D3ZM39	7.39e-175	540	1060	0.261	0.246	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
13	Q61495	1.68e-174	539	1057	0.261	0.247	DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus OX=10090 GN=Dsg1a PE=2 SV=2
14	Q7TSF1	2.61e-174	538	1060	0.261	0.246	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
15	Q7TSF0	4.45e-166	512	911	0.257	0.282	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
16	H2EQR6	1.60e-125	411	1142	0.314	0.275	DSG21_DANRE Desmoglein-2.1 OS=Danio rerio OX=7955 GN=dsg2.1 PE=2 SV=1
17	P55292	1.70e-99	335	902	0.271	0.300	DSC2_MOUSE Desmocollin-2 OS=Mus musculus OX=10090 GN=Dsc2 PE=1 SV=1
18	Q02487	6.04e-92	315	901	0.253	0.281	DSC2_HUMAN Desmocollin-2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1
19	P55850	7.97e-90	309	896	0.247	0.276	DSC3_MOUSE Desmocollin-3 OS=Mus musculus OX=10090 GN=Dsc3 PE=1 SV=3
20	A0A3B3ISU0	1.36e-89	305	758	0.242	0.319	A0A3B3ISU0_HUMAN Desmocollin 2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	3.3e-52	186.2	Cadherin domain
2	PF16184 Cadherin_3	0.23	22.8	Cadherin-like
3	PF01049 CADH_Y-type_LIR	0.14	23.7	Cadherin, Y-type LIR-motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257189

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331678	0.995	Plakophilin-3
2	9606.ENSP00000369129	0.989	Desmoplakin
3	9606.ENSP00000263946	0.970	Plakophilin-1
4	9606.ENSP00000377508	0.945	Junction plakoglobin
5	9606.ENSP00000070846	0.936	Plakophilin-2
6	9606.ENSP00000311032	0.932	Caspase-3
7	9606.ENSP00000344456	0.888	Catenin beta-1
8	9606.ENSP00000374409	0.866	Plakophilin-4
9	9606.ENSP00000340510	0.841	Periplakin
10	9606.ENSP00000301607	0.829	Envoplakin
11	9606.ENSP00000340937	0.816	Collagen alpha-1(XVII) chain
12	9606.ENSP00000353608	0.788	Desmocollin-3
13	9606.ENSP00000382004	0.786	Catenin delta-1
14	9606.ENSP00000357789	0.777	Filaggrin
15	9606.ENSP00000307959	0.762	Dystonin
16	9606.ENSP00000397157	0.751	P53 apoptosis effector related to PMP-22
17	9606.ENSP00000252252	0.734	Keratin, type II cytoskeletal 6B
18	9606.ENSP00000312663	0.721	Neuronal acetylcholine receptor subunit alpha-9
19	9606.ENSP00000257198	0.707	Desmocollin-1
20	9606.ENSP00000299698	0.699	Alpha-2-macroglobulin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0007155	0.944	cell adhesion
GO:0065007	0.646	biological regulation
GO:0050789	0.601	regulation of biological process
GO:0032502	0.542	developmental process
GO:0048856	0.527	anatomical structure development
GO:0050794	0.381	regulation of cellular process
GO:0032501	0.377	multicellular organismal process
GO:0071840	0.370	cellular component organization or biogenesis
GO:0016043	0.360	cellular component organization
GO:0050896	0.340	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.982	membrane-bounded organelle
GO:0005737	0.982	cytoplasm
GO:0030054	0.980	cell junction
GO:0070161	0.964	anchoring junction
GO:0005576	0.956	extracellular region
GO:0043229	0.931	intracellular organelle
GO:0005911	0.913	cell-cell junction
GO:0043230	0.901	extracellular organelle
GO:0005615	0.897	extracellular space
GO:0001533	0.897	cornified envelope
GO:1903561	0.876	extracellular vesicle
GO:0070062	0.861	extracellular exosome
GO:0043231	0.844	intracellular membrane-bounded organelle
GO:0005829	0.809	cytosol
GO:0030057	0.640	desmosome
GO:0012505	0.438	endomembrane system
GO:0005912	0.366	adherens junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]