StarFunc result for job id P32927

User Input

>input (897 residues)
MVLAQGLLSMALLALCWERSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQD
SWEDAAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSL
HTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTG
YNGIWSEWSEARSWDTESVLPMWVLALIVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWPPGSMSAFTSGSPPHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPAASHTPEKQASSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGPGQAVEVERRPSQ
GAAGSPSLESGGGPAPPALGPRVGGQDQKDSPVAIPMSSGDTEDPGVASGYVSSADLVFT
PNSGASSVSLVPSLGLPSDQTPSLCPGLASGPPGAPGPVKSGFEGYVELPPIEGRSPRSP
RNNPVPPEAKSPVLNPGERPADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSLRSKPS
SPGPGPEIKNLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32927	0.999	0.999	0.000	897	1.000	1.000	P32927.pdb.gz	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
2	AFDB:G3V608	0.500	0.501	5.387E-88	895	0.540	0.541	G3V608.pdb.gz	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
3	AFDB:P26955	0.512	0.512	1.276E-87	896	0.561	0.561	P26955.pdb.gz	IL3RB_MOUSE Cytokine receptor common subunit beta OS=Mus musculus OX=10090 GN=Csf2rb PE=1 SV=2
4	AFDB:Q4ZHG4	0.109	0.064	1.438E-18	1894	0.178	0.084	Q4ZHG4.pdb.gz	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
5	AFDB:Q2Q0I9	0.104	0.065	6.589E-18	1779	0.154	0.078	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
6	AFDB:F1R2D2	0.099	0.065	7.151E-17	1687	0.166	0.088	F1R2D2.pdb.gz
7	AFDB:O55005	0.099	0.069	1.129E-16	1651	0.149	0.081	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
8	AFDB:Q4VA61	0.114	0.054	3.380E-15	2053	0.143	0.062	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
9	AFDB:P13595	0.097	0.079	6.743E-14	1115	0.137	0.110	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
10	AFDB:D3ZB51	0.102	0.071	4.635E-13	1328	0.167	0.113	D3ZB51.pdb.gz	TUTLB_RAT Protein turtle homolog B OS=Rattus norvegicus OX=10116 GN=Igsf9b PE=1 SV=1
11	PDB:6pxvA	0.102	0.110	9.238E-10	823	0.055	0.060	6pxvA.pdb.gz
12	PDB:8dtlA	0.097	0.111	8.610E-9	741	0.055	0.066	8dtlA.pdb.gz
13	PDB:8eyyA	0.105	0.119	9.058E-9	775	0.050	0.058	8eyyA.pdb.gz
14	PDB:7u7nC	0.106	0.435	1.204E-7	200	0.047	0.210	7u7nC.pdb.gz
15	PDB:6pyhD	0.108	0.119	2.450E-7	798	0.050	0.056	6pyhD.pdb.gz
16	PDB:5mj3A	0.102	0.241	7.481E-7	302	0.055	0.162	5mj3A.pdb.gz
17	PDB:7z0lB	0.103	0.237	1.158E-5	370	0.042	0.103	7z0lB.pdb.gz
18	PDB:3besR	0.101	0.333	5.305E-5	250	0.025	0.088	3besR.pdb.gz
19	PDB:1hzhH	0.067	0.121	1.391E-4	457	0.049	0.096	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:4ziqA	0.096	0.067	1.463E-4	1450	0.057	0.035	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5Y685	0.0	603	540	0.334	0.556	A0A8I5Y685_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
2	A0A8I6GE59	0.0	632	787	0.411	0.469	A0A8I6GE59_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=1
3	G3V608	0.0	905	896	0.564	0.565	G3V608_RAT Colony stimulating factor 2 receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=4 SV=3
4	P26954	0.0	915	878	0.560	0.572	IL3B2_MOUSE Interleukin-3 receptor class 2 subunit beta OS=Mus musculus OX=10090 GN=Csf2rb2 PE=1 SV=1
5	P26955	0.0	922	896	0.565	0.566	IL3RB_MOUSE Cytokine receptor common subunit beta OS=Mus musculus OX=10090 GN=Csf2rb PE=1 SV=2
6	P32927	0.0	1810	897	1.000	1.000	IL3RB_HUMAN Cytokine receptor common subunit beta OS=Homo sapiens OX=9606 GN=CSF2RB PE=1 SV=2
7	Q78ZF5	0.0	894	896	0.560	0.560	Q78ZF5_RAT Interleukin-3 receptor beta-subunit OS=Rattus norvegicus OX=10116 GN=Csf2rb PE=2 SV=1
8	P24394	1.54e-12	73.9	825	0.069	0.075	IL4RA_HUMAN Interleukin-4 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL4R PE=1 SV=1
9	P34902	1.48e-09	63.2	369	0.065	0.157	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
10	P16382	2.33e-09	63.5	810	0.068	0.075	IL4RA_MOUSE Interleukin-4 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il4r PE=1 SV=1
11	Q561K3	6.90e-09	61.6	426	0.066	0.138	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
12	A0A8I6A7D4	7.82e-09	61.2	390	0.066	0.151	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
13	P31785	7.85e-09	60.8	369	0.067	0.163	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
14	Q63257	3.14e-08	60.1	801	0.070	0.079	IL4RA_RAT Interleukin-4 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il4r PE=2 SV=2
15	Q2VBQ8	1.63e-07	57.4	509	0.062	0.110	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
16	Q61190	3.30e-07	55.8	349	0.082	0.212	I10R2_MOUSE Interleukin-10 receptor subunit beta OS=Mus musculus OX=10090 GN=Il10rb PE=1 SV=1
17	A8WH93	6.36e-06	51.6	362	0.048	0.119	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
18	P16297	9.72e-06	51.6	539	0.068	0.113	IL2RB_MOUSE Interleukin-2 receptor subunit beta OS=Mus musculus OX=10090 GN=Il2rb PE=1 SV=1
19	Q14627	1.45e-05	50.8	380	0.066	0.155	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
20	Q9JHX3	1.62e-05	50.8	529	0.051	0.087	IL21R_MOUSE Interleukin-21 receptor OS=Mus musculus OX=10090 GN=Il21r PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	0.0036	28.8	Erythropoietin receptor, ligand binding
2	PF00041 fn3	8.6e-06	37.3	Fibronectin type III domain
3	PF18707 IL2RB_N1	0.024	26.5	Interleukin-2 receptor subunit beta N-terminal domain 1
4	PF09238 IL4Ra_N	0.00028	32.5	Interleukin-4 receptor alpha chain, N-terminal
5	PF09240 IL6Ra-bind	3.8e-05	35.4	Interleukin-6 receptor alpha chain, binding
6	PF09294 Interfer-bind	0.029	26.0	Interferon-alpha/beta receptor, fibronectin type III
7	PF16656 Pur_ac_phosph_N	41	16.2	Purple acid Phosphatase, N-terminal domain
8	PF01108 Tissue_fac	0.0045	28.2	Tissue factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296870	0.999	Interleukin-3
2	9606.ENSP00000296871	0.999	Granulocyte-macrophage colony-stimulating factor
3	9606.ENSP00000327890	0.998	Interleukin-3 receptor subunit alpha
4	9606.ENSP00000371067	0.996	Tyrosine-protein kinase JAK2
5	9606.ENSP00000394227	0.993	Granulocyte-macrophage colony-stimulating factor receptor subunit alpha
6	9606.ENSP00000401303	0.993	SHC-transforming protein 1
7	9606.ENSP00000412209	0.993	Interleukin-5 receptor subunit alpha
8	9606.ENSP00000231454	0.989	Interleukin-5
9	9606.ENSP00000391592	0.989	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000340944	0.984	Tyrosine-protein phosphatase non-receptor type 11
11	9606.ENSP00000341208	0.965	Signal transducer and activator of transcription 5A
12	9606.ENSP00000264657	0.962	Signal transducer and activator of transcription 3
13	9606.ENSP00000343204	0.960	Tyrosine-protein kinase JAK1
14	9606.ENSP00000428924	0.959	Tyrosine-protein kinase Lyn
15	9606.ENSP00000364907	0.943	Tyrosine-protein kinase SYK
16	9606.ENSP00000379287	0.943	14-3-3 protein zeta/delta
17	9606.ENSP00000293328	0.939	Signal transducer and activator of transcription 5B
18	9606.ENSP00000376345	0.938	Growth factor receptor-bound protein 2
19	9606.ENSP00000354394	0.931	Signal transducer and activator of transcription 1-alpha/beta
20	9606.ENSP00000405338	0.930	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0004914	0.879	interleukin-5 receptor activity
GO:0004912	0.879	interleukin-3 receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0007165	0.980	signal transduction
GO:0010033	0.965	response to organic substance
GO:0034097	0.935	response to cytokine
GO:0048518	0.922	positive regulation of biological process
GO:0048522	0.912	positive regulation of cellular process
GO:0007166	0.904	cell surface receptor signaling pathway
GO:0019221	0.877	cytokine-mediated signaling pathway
GO:0042127	0.770	regulation of cell population proliferation
GO:0008152	0.738	metabolic process
GO:0032501	0.679	multicellular organismal process
GO:0008284	0.672	positive regulation of cell population proliferation
GO:0071704	0.550	organic substance metabolic process
GO:0044238	0.522	primary metabolic process
GO:0044237	0.522	cellular metabolic process
GO:0006950	0.414	response to stress
GO:0070663	0.358	regulation of leukocyte proliferation
GO:0009605	0.345	response to external stimulus
GO:0019222	0.339	regulation of metabolic process
GO:0006807	0.318	nitrogen compound metabolic process
GO:0070665	0.318	positive regulation of leukocyte proliferation
GO:0043170	0.306	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.996	protein-containing complex
GO:0043235	0.894	receptor complex
GO:0098797	0.882	plasma membrane protein complex
GO:0098802	0.830	plasma membrane signaling receptor complex
GO:0005622	0.790	intracellular anatomical structure
GO:0043229	0.687	intracellular organelle
GO:0030526	0.680	granulocyte macrophage colony-stimulating factor receptor complex
GO:0043231	0.643	intracellular membrane-bounded organelle
GO:0005737	0.619	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]