StarFunc result for job id P32929

User Input

>input (405 residues)
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEY
SRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRY
FRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHG
DIILVVDNTFMSPYFQRPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQ
NSLGAVPSPIDCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQH
ELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVL
KNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPPSGSHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32929	1.000	1.000	4.096E-84	405	1.000	1.000	P32929.pdb.gz	CGL_HUMAN Cystathionine gamma-lyase OS=Homo sapiens OX=9606 GN=CTH PE=1 SV=3
2	PDB:3cogD	0.955	0.987	3.917E-76	392	0.963	0.995	3cogD.pdb.gz	Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S.
3	AFDB:P18757	0.974	0.991	6.291E-72	398	0.832	0.847	P18757.pdb.gz	CGL_RAT Cystathionine gamma-lyase OS=Rattus norvegicus OX=10116 GN=Cth PE=1 SV=2
4	AFDB:O97121	0.951	0.980	1.457E-62	393	0.593	0.611	O97121.pdb.gz	O97121_DROME cystathionine gamma-lyase OS=Drosophila melanogaster OX=7227 GN=Cth PE=3 SV=1
5	AFDB:P55216	0.950	0.982	1.692E-59	392	0.568	0.587	P55216.pdb.gz	CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans OX=6239 GN=cth-2 PE=3 SV=1
6	AFDB:C8VM61	0.917	0.887	2.038E-53	419	0.504	0.487	C8VM61.pdb.gz	C8VM61_EMENI Cystathionine gamma-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01446 PE=3 SV=1
7	AFDB:P31373	0.920	0.945	2.664E-51	394	0.494	0.508	P31373.pdb.gz	CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYS3 PE=1 SV=2
8	AFDB:O05394	0.915	0.978	3.524E-51	379	0.464	0.496	O05394.pdb.gz	MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) OX=224308 GN=mccB PE=1 SV=1
9	AFDB:P9WGB7	0.902	0.941	1.343E-49	388	0.447	0.466	P9WGB7.pdb.gz	METB_MYCTU Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metB PE=1 SV=1
10	AFDB:P53780	0.915	0.800	6.445E-49	464	0.390	0.341	P53780.pdb.gz	METC_ARATH Cystathionine beta-lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g57050 PE=1 SV=1
11	AFDB:X5E0F1	0.912	0.972	1.412E-48	380	0.420	0.447	X5E0F1.pdb.gz	X5E0F1_STAAU Bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase OS=Staphylococcus aureus OX=1280 GN=mccB PE=1 SV=1
12	PDB:1n8pA	0.909	0.936	7.156E-47	393	0.494	0.509	1n8pA.pdb.gz	Determinants of Enzymatic Specificity in the Cys-Met-Metabolism PLP-Dependent Enzymes Family: Crystal Structure of Cystathionine gamma-lyase from Yeast and Intrafamiliar Structural Comparison
13	PDB:7mcbH	0.902	0.960	3.247E-46	380	0.420	0.447	7mcbH.pdb.gz	Inhibitors of bacterial H 2 S biogenesis targeting antibiotic resistance and tolerance.
14	PDB:1ibjA	0.899	0.957	1.177E-45	380	0.388	0.413	1ibjA.pdb.gz	The three-dimensional structure of cystathionine beta-lyase from Arabidopsis and its substrate specificity
15	PDB:1cs1D	0.917	0.966	7.855E-44	384	0.385	0.406	1cs1D.pdb.gz	Crystal structure of Escherichia coli cystathionine gamma-synthase at 1.5 A resolution.
16	PDB:1cl1B	0.847	0.874	5.972E-36	392	0.294	0.304	1cl1B.pdb.gz	Crystal structure of the pyridoxal-5'-phosphate dependent cystathionine beta-lyase from Escherichia coli at 1.83 A.
17	PDB:5ft8A	0.566	0.571	1.019E-13	401	0.146	0.147	5ft8A.pdb.gz	Mechanism of Sulfur Transfer Across Protein-Protein Interfaces: The Cysteine Desulfurase Model System
18	PDB:4k2mA	0.569	0.526	6.844E-13	442	0.146	0.133	4k2mA.pdb.gz	The Structure of NtdA, a Sugar Aminotransferase Involved in the Kanosamine Biosynthetic Pathway in Bacillus subtilis, Reveals a New Subclass of Aminotransferases.
19	PDB:3fvsA	0.503	0.489	8.562E-13	419	0.178	0.172	3fvsA.pdb.gz	Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
20	PDB:5wmlA	0.477	0.479	1.585E-12	404	0.151	0.151	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O97121	0.0	516	393	0.593	0.611	O97121_DROME cystathionine gamma-lyase OS=Drosophila melanogaster OX=7227 GN=Cth PE=3 SV=1
2	P18757	0.0	707	398	0.832	0.847	CGL_RAT Cystathionine gamma-lyase OS=Rattus norvegicus OX=10116 GN=Cth PE=1 SV=2
3	P32929	0.0	847	405	1.000	1.000	CGL_HUMAN Cystathionine gamma-lyase OS=Homo sapiens OX=9606 GN=CTH PE=1 SV=3
4	Q7JXZ2	0.0	518	393	0.595	0.613	Q7JXZ2_DROME cystathionine gamma-lyase OS=Drosophila melanogaster OX=7227 GN=Cth PE=1 SV=1
5	Q8VCN5	0.0	709	398	0.840	0.854	CGL_MOUSE Cystathionine gamma-lyase OS=Mus musculus OX=10090 GN=Cth PE=1 SV=1
6	P55216	2.56e-166	473	392	0.568	0.587	CGL2_CAEEL Putative cystathionine gamma-lyase 2 OS=Caenorhabditis elegans OX=6239 GN=cth-2 PE=3 SV=1
7	C8VM61	1.50e-133	391	419	0.501	0.484	C8VM61_EMENI Cystathionine gamma-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01446 PE=3 SV=1
8	P31373	1.88e-131	385	394	0.494	0.508	CYS3_YEAST Cystathionine gamma-lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYS3 PE=1 SV=2
9	O05394	1.53e-123	364	379	0.464	0.496	MCCB_BACSU Cystathionine gamma-lyase OS=Bacillus subtilis (strain 168) OX=224308 GN=mccB PE=1 SV=1
10	P9WGB7	7.37e-114	340	388	0.444	0.464	METB_MYCTU Cystathionine gamma-synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=metB PE=1 SV=1
11	X5E0F1	2.75e-112	335	380	0.422	0.450	X5E0F1_STAAU Bifunctional cystathionine gamma-lyase/homocysteine desulfhydrase OS=Staphylococcus aureus OX=1280 GN=mccB PE=1 SV=1
12	P53780	9.31e-107	324	464	0.390	0.341	METC_ARATH Cystathionine beta-lyase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At3g57050 PE=1 SV=1
13	Q5MQ31	8.20e-102	310	425	0.420	0.400	Q5MQ31_BRELN L-methionine-gamma-lyase OS=Brevibacterium linens OX=1703 GN=mgl PE=3 SV=1
14	P00935	8.08e-94	288	386	0.393	0.412	METB_ECOLI Cystathionine gamma-synthase OS=Escherichia coli (strain K12) OX=83333 GN=metB PE=1 SV=1
15	E9AFE7	5.54e-88	274	409	0.385	0.381	E9AFE7_LEIMA Putative cystathione gamma lyase OS=Leishmania major OX=5664 GN=LMJF_35_3230 PE=3 SV=1
16	Q38DH3	1.27e-86	272	445	0.388	0.353	Q38DH3_TRYB2 Cystathione gamma lyase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3330 PE=3 SV=1
17	P55217	4.11e-81	261	563	0.353	0.254	CGS1_ARATH Cystathionine gamma-synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CGS1 PE=1 SV=3
18	Q5AXC9	2.46e-80	256	458	0.368	0.325	Q5AXC9_EMENI Cystathionine beta-lyase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=metG PE=3 SV=1
19	O94350	1.22e-77	247	390	0.333	0.346	CBL_SCHPO Cystathionine beta-lyase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=str3 PE=3 SV=4
20	P55218	5.94e-76	243	403	0.323	0.325	METZ_PSEAE O-succinylhomoserine sulfhydrylase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=metZ PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	0.00082	30.3	Aminotransferase class I and II
2	PF00266 Aminotran_5	0.14	22.7	Aminotransferase class-V
3	PF01053 Cys_Met_Meta_PP	4.3e-154	524.3	Cys/Met metabolism PLP-dependent enzyme
4	PF01041 DegT_DnrJ_EryC1	0.3	21.9	DegT/DnrJ/EryC1/StrS aminotransferase family
5	PF02347 GDC-P	2.1e+02	12.1	Glycine cleavage system P-protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359976

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381231	0.999	Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L- homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine. Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons.
2	9606.ENSP00000380402	0.995	3-mercaptopyruvate sulfurtransferase
3	9606.ENSP00000381234	0.987	annotation not available
4	9606.ENSP00000229416	0.980	Glutamate-cysteine ligase catalytic subunit
5	9606.ENSP00000355536	0.978	Methionine synthase
6	9606.ENSP00000385828	0.977	Thiosulfate sulfurtransferase
7	9606.ENSP00000274353	0.962	Betaine--homocysteine S-methyltransferase 1
8	9606.ENSP00000217426	0.960	Adenosylhomocysteinase
9	9606.ENSP00000359539	0.957	Aspartate aminotransferase, cytoplasmic
10	9606.ENSP00000399415	0.956	Kynurenine--oxoglutarate transaminase 1
11	9606.ENSP00000260508	0.953	Kynurenine--oxoglutarate transaminase 3
12	9606.ENSP00000262027	0.946	Methionine--tRNA ligase, cytoplasmic
13	9606.ENSP00000434516	0.942	Thioredoxin reductase 1, cytoplasmic
14	9606.ENSP00000443459	0.941	Branched-chain-amino-acid aminotransferase, cytosolic
15	9606.ENSP00000245206	0.937	Aspartate aminotransferase, mitochondrial
16	9606.ENSP00000322991	0.934	Branched-chain-amino-acid aminotransferase, mitochondrial
17	9606.ENSP00000257549	0.928	L-serine dehydratase/L-threonine deaminase
18	9606.ENSP00000303077	0.928	Putative aspartate aminotransferase, cytoplasmic 2
19	9606.ENSP00000250535	0.925	Cysteine dioxygenase type 1
20	9606.ENSP00000231420	0.919	Alanine--glyoxylate aminotransferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043168	1.000	anion binding
GO:0016846	1.000	carbon-sulfur lyase activity
GO:0070279	1.000	vitamin B6 binding
GO:0005515	0.997	protein binding
GO:0030170	0.993	pyridoxal phosphate binding
GO:0042802	0.985	identical protein binding
GO:0004123	0.739	cystathionine gamma-lyase activity
GO:0016740	0.616	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0044281	0.977	small molecule metabolic process
GO:0065007	0.939	biological regulation
GO:0006520	0.936	amino acid metabolic process
GO:0009058	0.908	biosynthetic process
GO:0044249	0.899	cellular biosynthetic process
GO:1901605	0.895	alpha-amino acid metabolic process
GO:1901566	0.892	organonitrogen compound biosynthetic process
GO:0050789	0.608	regulation of biological process
GO:0050794	0.533	regulation of cellular process
GO:0006790	0.516	sulfur compound metabolic process
GO:0009069	0.464	serine family amino acid metabolic process
GO:0044283	0.399	small molecule biosynthetic process
GO:0000096	0.380	sulfur amino acid metabolic process
GO:1901607	0.345	alpha-amino acid biosynthetic process
GO:0050896	0.334	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.998	membrane-bounded organelle
GO:0031982	0.943	vesicle
GO:0005576	0.905	extracellular region
GO:0043230	0.878	extracellular organelle
GO:0070062	0.861	extracellular exosome
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0070013	0.487	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.4.-.-	1.000	Carbon-sulfur lyases.
RHEA:14005	0.739	H2O + L,L-cystathionine = 2-oxobutanoate + L-cysteine + NH4(+)
EC:4.4.1.1	0.739	cystathionine gamma-lyase.
EC:2.-.-.-	0.616	Transferases.

[back to server]