StarFunc result for job id P32970

User Input

>input (193 residues)
MPEEGSGCSVRRRPYGCVLRAALVPLVAGLVICLVVCIQRFAQAQQQLPLESLGWDVAEL
QLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTA
SRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRN
TDETFFGVQWVRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32970	1.000	1.000	4.304E-35	193	1.000	1.000	P32970.pdb.gz	CD70_HUMAN CD70 antigen OS=Homo sapiens OX=9606 GN=CD70 PE=1 SV=2
2	AFDB:P48023	0.582	0.409	1.181E-10	281	0.207	0.142	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
3	AFDB:O95150	0.549	0.429	2.330E-10	251	0.269	0.207	O95150.pdb.gz	TNF15_HUMAN Tumor necrosis factor ligand superfamily member 15 OS=Homo sapiens OX=9606 GN=TNFSF15 PE=1 SV=2
4	AFDB:Q0PKX7	0.576	0.424	5.380E-10	268	0.223	0.160	Q0PKX7.pdb.gz	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
5	AFDB:Q1JQ40	0.586	0.475	6.631E-10	242	0.238	0.190	Q1JQ40.pdb.gz
6	AFDB:O43557	0.587	0.479	7.758E-10	240	0.212	0.171	O43557.pdb.gz	TNF14_HUMAN Tumor necrosis factor ligand superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFSF14 PE=1 SV=2
7	AFDB:Q9DEP9	0.581	0.450	1.309E-9	255	0.212	0.161	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
8	AFDB:P41047	0.581	0.410	1.379E-9	279	0.207	0.143	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
9	AFDB:Q9QYH9	0.596	0.488	1.453E-9	239	0.238	0.192	Q9QYH9.pdb.gz	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
10	AFDB:Q8K3Y7	0.587	0.457	2.095E-9	252	0.228	0.175	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
11	PDB:7e57B	0.462	0.697	2.730E-5	123	0.098	0.154	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
12	PDB:5h4bA	0.507	0.692	4.364E-4	136	0.104	0.147	5h4bA.pdb.gz
13	PDB:5kc6B	0.440	0.568	5.106E-4	144	0.093	0.125	5kc6B.pdb.gz
14	PDB:5hlyA	0.345	0.252	7.352E-3	299	0.062	0.040	5hlyA.pdb.gz
15	PDB:4fixA	0.294	0.113	8.162E-3	629	0.119	0.037	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
16	PDB:4tlgA	0.251	0.136	2.323E-2	396	0.052	0.025	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
17	PDB:7bhqB	0.248	0.238	2.323E-2	204	0.104	0.098	7bhqB.pdb.gz
18	PDB:7rslA	0.354	0.307	2.863E-2	235	0.114	0.094	7rslA.pdb.gz
19	PDB:5jovA	0.199	0.059	3.179E-2	949	0.062	0.013	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
20	PDB:7l2zF	0.299	0.101	4.585E-2	664	0.073	0.021	7l2zF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32970	4.85e-141	392	193	1.000	1.000	CD70_HUMAN CD70 antigen OS=Homo sapiens OX=9606 GN=CD70 PE=1 SV=2
2	Q1L8A5	0.32	33.5	234	0.187	0.154	Q1L8A5_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=1 SV=1
3	Q08CQ3	0.34	33.5	234	0.187	0.154	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
4	Q9D5L7	2.0	31.2	273	0.114	0.081	SPSB1_MOUSE SPRY domain-containing SOCS box protein 1 OS=Mus musculus OX=10090 GN=Spsb1 PE=1 SV=1
5	Q96BD6	2.1	31.2	273	0.114	0.081	SPSB1_HUMAN SPRY domain-containing SOCS box protein 1 OS=Homo sapiens OX=9606 GN=SPSB1 PE=1 SV=1
6	P29965	2.2	31.2	261	0.104	0.077	CD40L_HUMAN CD40 ligand OS=Homo sapiens OX=9606 GN=CD40LG PE=1 SV=1
7	P08661	4.7	30.0	244	0.098	0.078	MBL2_RAT Mannose-binding protein C OS=Rattus norvegicus OX=10116 GN=Mbl2 PE=1 SV=2
8	Q8IXQ9	5.9	29.6	262	0.083	0.061	ETKMT_HUMAN Electron transfer flavoprotein beta subunit lysine methyltransferase OS=Homo sapiens OX=9606 GN=ETFBKMT PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	0.0045	28.3	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245903

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266557	0.999	CD27 antigen
2	9606.ENSP00000320084	0.857	CD276 antigen
3	9606.ENSP00000398698	0.830	Tumor necrosis factor
4	9606.ENSP00000245817	0.797	Tumor necrosis factor ligand superfamily member 9
5	9606.ENSP00000386559	0.760	T-cell surface glycoprotein CD8 alpha chain
6	9606.ENSP00000281834	0.746	Tumor necrosis factor ligand superfamily member 4
7	9606.ENSP00000359663	0.739	CD40 ligand
8	9606.ENSP00000368538	0.719	Tumor necrosis factor receptor superfamily member 4
9	9606.ENSP00000361359	0.714	Tumor necrosis factor receptor superfamily member 5
10	9606.ENSP00000011653	0.701	T-cell surface glycoprotein CD4
11	9606.ENSP00000264246	0.697	T-lymphocyte activation antigen CD80
12	9606.ENSP00000478699	0.696	Tumor necrosis factor receptor superfamily member 9
13	9606.ENSP00000332049	0.688	T-lymphocyte activation antigen CD86
14	9606.ENSP00000223795	0.687	Tumor necrosis factor ligand superfamily member 8
15	9606.ENSP00000339477	0.684	Inducible T-cell co-stimulator ligand
16	9606.ENSP00000324890	0.680	T-cell-specific surface glycoprotein CD28
17	9606.ENSP00000303939	0.663	Cytotoxic T-lymphocyte protein 4
18	9606.ENSP00000385470	0.640	Tumor necrosis factor ligand superfamily member 18
19	9606.ENSP00000263932	0.638	Tumor necrosis factor receptor superfamily member 8
20	9606.ENSP00000370989	0.610	Programmed cell death 1 ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:0005125	1.000	cytokine activity
GO:0005126	0.440	cytokine receptor binding
GO:0032813	0.313	tumor necrosis factor receptor superfamily binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0042129	0.997	regulation of T cell proliferation
GO:0051240	0.996	positive regulation of multicellular organismal process
GO:0048522	0.994	positive regulation of cellular process
GO:0002252	0.990	immune effector process
GO:0002684	0.985	positive regulation of immune system process
GO:1903037	0.985	regulation of leukocyte cell-cell adhesion
GO:0097190	0.985	apoptotic signaling pathway
GO:0007166	0.983	cell surface receptor signaling pathway
GO:0046649	0.981	lymphocyte activation
GO:0042102	0.978	positive regulation of T cell proliferation
GO:0006955	0.977	immune response
GO:0002460	0.972	adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002449	0.967	lymphocyte mediated immunity
GO:0007267	0.944	cell-cell signaling
GO:0042113	0.942	B cell activation
GO:0046651	0.908	lymphocyte proliferation
GO:0042100	0.874	B cell proliferation
GO:0019724	0.860	B cell mediated immunity
GO:0002456	0.842	T cell mediated immunity
GO:0097191	0.498	extrinsic apoptotic signaling pathway
GO:0019222	0.448	regulation of metabolic process
GO:0060255	0.434	regulation of macromolecule metabolic process
GO:0009893	0.428	positive regulation of metabolic process
GO:0048583	0.416	regulation of response to stimulus
GO:0010604	0.391	positive regulation of macromolecule metabolic process
GO:0010468	0.328	regulation of gene expression
GO:0001817	0.310	regulation of cytokine production
GO:0048584	0.306	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005576	0.999	extracellular region
GO:0043227	0.996	membrane-bounded organelle
GO:0070062	0.992	extracellular exosome
GO:0005622	0.600	intracellular anatomical structure
GO:0043231	0.332	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]