StarFunc result for job id P32971

User Input

>input (234 residues)
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVL
VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGI
LHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESG
MQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32971	1.000	1.000	6.031E-42	234	1.000	1.000	P32971.pdb.gz	TNFL8_HUMAN Tumor necrosis factor ligand superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFSF8 PE=1 SV=1
2	AFDB:P32972	0.643	0.630	3.414E-31	239	0.714	0.699	P32972.pdb.gz	TNFL8_MOUSE Tumor necrosis factor ligand superfamily member 8 OS=Mus musculus OX=10090 GN=Tnfsf8 PE=2 SV=1
3	AFDB:P41047	0.469	0.398	7.488E-12	279	0.179	0.151	P41047.pdb.gz	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
4	AFDB:Q1JQ40	0.519	0.503	7.488E-12	242	0.167	0.161	Q1JQ40.pdb.gz
5	AFDB:E7F3U1	0.518	0.485	8.345E-12	251	0.201	0.187	E7F3U1.pdb.gz	E7F3U1_DANRE TNF superfamily member 11 OS=Danio rerio OX=7955 GN=tnfsf11 PE=3 SV=1
6	AFDB:Q0PKX7	0.504	0.444	1.219E-11	268	0.209	0.183	Q0PKX7.pdb.gz	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
7	AFDB:Q8K3Y7	0.486	0.453	1.782E-11	252	0.192	0.179	Q8K3Y7.pdb.gz	TNF15_RAT Tumor necrosis factor ligand superfamily member 15 OS=Rattus norvegicus OX=10116 GN=Tnfsf15 PE=2 SV=1
8	AFDB:Q9DEP9	0.495	0.457	1.782E-11	255	0.209	0.192	Q9DEP9.pdb.gz	Q9DEP9_ONCMY Tumor necrosis factor OS=Oncorhynchus mykiss OX=8022 GN=tnf PE=2 SV=1
9	AFDB:P48023	0.489	0.411	2.604E-11	281	0.158	0.132	P48023.pdb.gz	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
10	AFDB:Q08CQ3	0.519	0.519	4.240E-11	234	0.150	0.150	Q08CQ3.pdb.gz	Q08CQ3_DANRE Lymphotoxin-alpha OS=Danio rerio OX=7955 GN=tnfa PE=2 SV=1
11	PDB:5h4bA	0.347	0.552	2.555E-5	136	0.068	0.118	5h4bA.pdb.gz
12	PDB:7e57B	0.388	0.697	3.006E-5	123	0.090	0.171	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
13	PDB:5kc6B	0.426	0.657	9.379E-5	144	0.056	0.090	5kc6B.pdb.gz
14	PDB:5eiyB	0.222	0.099	9.901E-3	658	0.051	0.018	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
15	PDB:7l2zF	0.252	0.102	1.702E-2	664	0.038	0.014	7l2zF.pdb.gz
16	PDB:3cl5A	0.280	0.200	1.897E-2	358	0.068	0.045	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
17	PDB:5jovA	0.207	0.062	2.772E-2	949	0.043	0.011	5jovA.pdb.gz	Structural dissection of a complex Bacteroides ovatus gene locus conferring xyloglucan metabolism in the human gut.
18	PDB:2waaA	0.128	0.102	3.089E-2	335	0.073	0.051	2waaA.pdb.gz
19	PDB:3i26D	0.228	0.162	3.089E-2	369	0.043	0.027	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
20	PDB:5nxsA	0.215	0.184	4.275E-2	290	0.068	0.055	5nxsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32971	1.55e-175	483	234	1.000	1.000	TNFL8_HUMAN Tumor necrosis factor ligand superfamily member 8 OS=Homo sapiens OX=9606 GN=TNFSF8 PE=1 SV=1
2	P32972	1.54e-118	339	239	0.714	0.699	TNFL8_MOUSE Tumor necrosis factor ligand superfamily member 8 OS=Mus musculus OX=10090 GN=Tnfsf8 PE=2 SV=1
3	P41047	0.011	38.5	279	0.145	0.122	TNFL6_MOUSE Tumor necrosis factor ligand superfamily member 6 OS=Mus musculus OX=10090 GN=Faslg PE=1 SV=1
4	E9AE57	0.024	37.7	568	0.107	0.044	FUM2_LEIMA Fumarate hydratase 2 OS=Leishmania major OX=5664 GN=FH2 PE=1 SV=1
5	P48023	0.17	35.0	281	0.068	0.057	TNFL6_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=1 SV=1
6	Q0VHD7	0.17	35.0	281	0.068	0.057	Q0VHD7_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=FASLG PE=2 SV=1
7	Q53ZZ1	0.17	35.0	281	0.068	0.057	Q53ZZ1_HUMAN Tumor necrosis factor ligand superfamily member 6 OS=Homo sapiens OX=9606 GN=TNFSF6 PE=2 SV=1
8	B8YI05	0.49	33.5	260	0.094	0.085	B8YI05_DANRE CD154 OS=Danio rerio OX=7955 GN=cd40lg PE=2 SV=1
9	Q0PKX7	0.75	33.1	268	0.064	0.056	Q0PKX7_DANRE Fas ligand OS=Danio rerio OX=7955 GN=fasl PE=2 SV=1
10	P71594	1.1	32.3	281	0.077	0.064	P71594_MYCTU Secreted protein P60-related protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0024 PE=3 SV=2
11	P36940	1.2	32.3	278	0.060	0.050	TNFL6_RAT Tumor necrosis factor ligand superfamily member 6 OS=Rattus norvegicus OX=10116 GN=Faslg PE=2 SV=1
12	Q96301	1.4	32.3	914	0.085	0.022	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
13	Q10155	2.5	31.6	809	0.115	0.033	RNZ1_SCHPO Ribonuclease Z 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trz1 PE=3 SV=1
14	P01375	3.7	30.8	233	0.103	0.103	TNFA_HUMAN Tumor necrosis factor OS=Homo sapiens OX=9606 GN=TNF PE=1 SV=1
15	Q9QYH9	3.7	30.8	239	0.060	0.059	TNF14_MOUSE Tumor necrosis factor ligand superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfsf14 PE=2 SV=1
16	C1K3N5	3.8	30.8	232	0.103	0.103	C1K3N5_HUMAN Tumor necrosis factor (Fragment) OS=Homo sapiens OX=9606 GN=TNF PE=2 SV=1
17	E7F3U1	4.2	30.4	251	0.128	0.120	E7F3U1_DANRE TNF superfamily member 11 OS=Danio rerio OX=7955 GN=tnfsf11 PE=3 SV=1
18	O43508	8.3	29.6	249	0.068	0.064	TNF12_HUMAN Tumor necrosis factor ligand superfamily member 12 OS=Homo sapiens OX=9606 GN=TNFSF12 PE=1 SV=1
19	Q4ACW9	8.3	29.6	249	0.068	0.064	Q4ACW9_HUMAN HCG1991317, isoform CRA_b OS=Homo sapiens OX=9606 GN=TWEAK PE=1 SV=1
20	B7ZD88	8.8	30.0	1203	0.060	0.012	B7ZD88_DANRE WD repeat-containing protein 35 OS=Danio rerio OX=7955 GN=im:7159945 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00229 TNF	2.4e-20	84.2	TNF(Tumour Necrosis Factor) family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223795

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263932	0.998	Tumor necrosis factor receptor superfamily member 8
2	9606.ENSP00000361359	0.779	Tumor necrosis factor receptor superfamily member 5
3	9606.ENSP00000281834	0.697	Tumor necrosis factor ligand superfamily member 4
4	9606.ENSP00000245903	0.687	CD70 antigen
5	9606.ENSP00000245817	0.681	Tumor necrosis factor ligand superfamily member 9
6	9606.ENSP00000368538	0.661	Tumor necrosis factor receptor superfamily member 4
7	9606.ENSP00000359663	0.650	CD40 ligand
8	9606.ENSP00000386559	0.640	T-cell surface glycoprotein CD8 alpha chain
9	9606.ENSP00000363157	0.619	Tumor necrosis factor ligand superfamily member 15
10	9606.ENSP00000011653	0.603	T-cell surface glycoprotein CD4
11	9606.ENSP00000482259	0.588	C-C motif chemokine 4
12	9606.ENSP00000398698	0.579	Tumor necrosis factor
13	9606.ENSP00000478699	0.577	Tumor necrosis factor receptor superfamily member 9
14	9606.ENSP00000332049	0.570	T-lymphocyte activation antigen CD86
15	9606.ENSP00000333919	0.565	B- and T-lymphocyte attenuator
16	9606.ENSP00000385470	0.561	Tumor necrosis factor ligand superfamily member 18
17	9606.ENSP00000266557	0.552	CD27 antigen
18	9606.ENSP00000347948	0.552	Tumor necrosis factor receptor superfamily member 14
19	9606.ENSP00000433761	0.535	Membrane-spanning 4-domains subfamily A member 14
20	9606.ENSP00000365435	0.530	Tumor necrosis factor receptor superfamily member 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.683	cytokine receptor binding
GO:0098772	0.463	molecular function regulator activity
GO:0032813	0.393	tumor necrosis factor receptor superfamily binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.994	cellular process
GO:0042127	0.972	regulation of cell population proliferation
GO:0050865	0.970	regulation of cell activation
GO:0007154	0.954	cell communication
GO:0023052	0.938	signaling
GO:0051249	0.928	regulation of lymphocyte activation
GO:0050896	0.926	response to stimulus
GO:0048518	0.893	positive regulation of biological process
GO:0048522	0.865	positive regulation of cellular process
GO:0051716	0.806	cellular response to stimulus
GO:0070663	0.717	regulation of leukocyte proliferation
GO:0007165	0.712	signal transduction
GO:0019222	0.707	regulation of metabolic process
GO:0050670	0.667	regulation of lymphocyte proliferation
GO:0050863	0.648	regulation of T cell activation
GO:0060255	0.637	regulation of macromolecule metabolic process
GO:0002376	0.625	immune system process
GO:0007267	0.601	cell-cell signaling
GO:0009893	0.517	positive regulation of metabolic process
GO:0042129	0.471	regulation of T cell proliferation
GO:0032501	0.442	multicellular organismal process
GO:0080090	0.437	regulation of primary metabolic process
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0010468	0.434	regulation of gene expression
GO:0051171	0.432	regulation of nitrogen compound metabolic process
GO:0031323	0.429	regulation of cellular metabolic process
GO:0009605	0.397	response to external stimulus
GO:0006955	0.380	immune response
GO:0051240	0.359	positive regulation of multicellular organismal process
GO:0002684	0.348	positive regulation of immune system process
GO:0006950	0.345	response to stress
GO:0048519	0.338	negative regulation of biological process
GO:0048583	0.309	regulation of response to stimulus
GO:0032502	0.308	developmental process
GO:0048523	0.306	negative regulation of cellular process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process
GO:0007166	0.301	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.745	intracellular anatomical structure
GO:0043226	0.595	organelle
GO:0009986	0.459	cell surface
GO:0043227	0.448	membrane-bounded organelle
GO:0005576	0.446	extracellular region
GO:0005737	0.404	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]