StarFunc result for job id P33032

User Input

>input (325 residues)
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33032	1.000	1.000	2.468E-42	325	1.000	1.000	P33032.pdb.gz	MC5R_HUMAN Melanocortin receptor 5 OS=Homo sapiens OX=9606 GN=MC5R PE=1 SV=3
2	AFDB:P35345	0.888	0.888	7.439E-32	325	0.809	0.809	P35345.pdb.gz	MC5R_RAT Melanocortin receptor 5 OS=Rattus norvegicus OX=10116 GN=Mc5r PE=2 SV=1
3	AFDB:P41968	0.825	0.830	2.681E-26	323	0.575	0.579	P41968.pdb.gz	MC3R_HUMAN Melanocortin receptor 3 OS=Homo sapiens OX=9606 GN=MC3R PE=1 SV=3
4	AFDB:B0V1P1	0.824	0.821	2.929E-26	326	0.612	0.610	B0V1P1.pdb.gz	MC4R_DANRE Melanocortin receptor 4 OS=Danio rerio OX=7955 GN=mc4r PE=1 SV=1
5	AFDB:P32244	0.825	0.829	3.821E-26	323	0.572	0.576	P32244.pdb.gz	MC3R_RAT Melanocortin receptor 3 OS=Rattus norvegicus OX=10116 GN=Mc3r PE=2 SV=2
6	AFDB:P32245	0.852	0.835	1.012E-24	332	0.615	0.602	P32245.pdb.gz	MC4R_HUMAN Melanocortin receptor 4 OS=Homo sapiens OX=9606 GN=MC4R PE=1 SV=2
7	PDB:7f53R	0.752	0.888	1.771E-22	273	0.582	0.692	7f53R.pdb.gz	Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
8	AFDB:Q7ZTA3	0.820	0.825	6.209E-22	323	0.480	0.483	Q7ZTA3.pdb.gz	Q7ZTA3_DANRE Melanocyte-stimulating hormone receptor OS=Danio rerio OX=7955 GN=mc1r PE=2 SV=1
9	AFDB:A7Y4C2	0.796	0.845	2.242E-21	305	0.428	0.456	A7Y4C2.pdb.gz	A7Y4C2_ONCMY Putative melanocortin 2 receptor OS=Oncorhynchus mykiss OX=8022 GN=MC2R PE=2 SV=1
10	AFDB:Q01718	0.818	0.893	2.241E-20	297	0.418	0.458	Q01718.pdb.gz	ACTHR_HUMAN Adrenocorticotropic hormone receptor OS=Homo sapiens OX=9606 GN=MC2R PE=1 SV=1
11	AFDB:F1Q9X5	0.804	0.856	2.796E-20	304	0.406	0.434	F1Q9X5.pdb.gz
12	PDB:7f4fR	0.746	0.894	8.707E-18	269	0.400	0.483	7f4fR.pdb.gz	Structural mechanism of calcium-mediated hormone recognition and G beta interaction by the human melanocortin-1 receptor.
13	PDB:7td1R	0.697	0.767	2.871E-11	293	0.237	0.263	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
14	PDB:7wv9R	0.718	0.797	1.927E-10	290	0.228	0.255	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
15	PDB:6gdgA	0.624	0.753	2.746E-10	264	0.234	0.288	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.
16	PDB:7yu4A	0.621	0.750	3.426E-10	266	0.212	0.259	7yu4A.pdb.gz	Structure of the active G i -coupled human lysophosphatidic acid receptor 1 complexed with a potent agonist.
17	PDB:3emlA	0.706	0.520	7.273E-10	448	0.252	0.183	3emlA.pdb.gz	The 2.6 Angstrom Crystal Structure of a Human A2A Adenosine Receptor Bound to an Antagonist.
18	PDB:7td3R	0.668	0.737	9.075E-10	292	0.252	0.281	7td3R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.
19	PDB:6g79S	0.625	0.761	9.915E-10	262	0.212	0.263	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
20	PDB:7e32R	0.645	0.726	9.915E-10	285	0.218	0.249	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33032	0.0	664	325	1.000	1.000	MC5R_HUMAN Melanocortin receptor 5 OS=Homo sapiens OX=9606 GN=MC5R PE=1 SV=3
2	P35345	0.0	545	325	0.812	0.812	MC5R_RAT Melanocortin receptor 5 OS=Rattus norvegicus OX=10116 GN=Mc5r PE=2 SV=1
3	B0V1P1	2.55e-143	409	326	0.634	0.632	MC4R_DANRE Melanocortin receptor 4 OS=Danio rerio OX=7955 GN=mc4r PE=1 SV=1
4	P70596	2.29e-138	397	332	0.631	0.617	MC4R_RAT Melanocortin receptor 4 OS=Rattus norvegicus OX=10116 GN=Mc4r PE=2 SV=1
5	P41968	1.43e-137	394	323	0.606	0.610	MC3R_HUMAN Melanocortin receptor 3 OS=Homo sapiens OX=9606 GN=MC3R PE=1 SV=3
6	P56450	2.77e-137	394	332	0.634	0.620	MC4R_MOUSE Melanocortin receptor 4 OS=Mus musculus OX=10090 GN=Mc4r PE=1 SV=3
7	P32245	7.08e-137	393	332	0.622	0.608	MC4R_HUMAN Melanocortin receptor 4 OS=Homo sapiens OX=9606 GN=MC4R PE=1 SV=2
8	P32244	2.00e-135	389	323	0.578	0.582	MC3R_RAT Melanocortin receptor 3 OS=Rattus norvegicus OX=10116 GN=Mc3r PE=2 SV=2
9	P33033	1.23e-133	384	323	0.585	0.588	MC3R_MOUSE Melanocortin receptor 3 OS=Mus musculus OX=10090 GN=Mc3r PE=2 SV=1
10	Q7ZTA3	1.22e-100	300	323	0.514	0.517	Q7ZTA3_DANRE Melanocyte-stimulating hormone receptor OS=Danio rerio OX=7955 GN=mc1r PE=2 SV=1
11	B6ZGR5	7.69e-92	278	317	0.452	0.464	B6ZGR5_RAT Melanocyte-stimulating hormone receptor OS=Rattus norvegicus OX=10116 GN=Mc1r PE=3 SV=1
12	Q01718	5.85e-91	275	297	0.412	0.451	ACTHR_HUMAN Adrenocorticotropic hormone receptor OS=Homo sapiens OX=9606 GN=MC2R PE=1 SV=1
13	A7Y4C2	1.44e-90	274	305	0.431	0.459	A7Y4C2_ONCMY Putative melanocortin 2 receptor OS=Oncorhynchus mykiss OX=8022 GN=MC2R PE=2 SV=1
14	Q01727	1.11e-89	272	315	0.437	0.451	MSHR_MOUSE Melanocyte-stimulating hormone receptor OS=Mus musculus OX=10090 GN=Mc1r PE=2 SV=2
15	G3V848	3.35e-89	270	296	0.412	0.453	G3V848_RAT Adrenocorticotropic hormone receptor OS=Rattus norvegicus OX=10116 GN=Mc2r PE=3 SV=1
16	Q01726	8.15e-89	270	317	0.434	0.445	MSHR_HUMAN Melanocyte-stimulating hormone receptor OS=Homo sapiens OX=9606 GN=MC1R PE=1 SV=2
17	Q7ZTA2	3.34e-83	255	304	0.400	0.428	Q7ZTA2_DANRE Adrenocorticotropic hormone receptor OS=Danio rerio OX=7955 GN=mc2r PE=3 SV=1
18	A0A0B4J269	3.98e-83	269	797	0.422	0.172	A0A0B4J269_HUMAN G-protein coupled receptors family 1 profile domain-containing protein OS=Homo sapiens OX=9606 PE=1 SV=1
19	F1QFF1	5.20e-32	124	356	0.283	0.258	F1QFF1_DANRE Lysophosphatidic acid receptor 2 isoform X1 OS=Danio rerio OX=7955 GN=zgc:101053 PE=3 SV=1
20	Q6DC27	8.01e-31	121	356	0.280	0.256	Q6DC27_DANRE Lysophosphatidic acid receptor 2 OS=Danio rerio OX=7955 GN=zgc:101053 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	2.1e-33	127.3	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	9.5e-09	47.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	5.2e-05	34.3	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384092	0.987	Pro-opiomelanocortin
2	9606.ENSP00000257776	0.909	Melanocortin-2 receptor accessory protein 2
3	9606.ENSP00000384364	0.747	Pro-neuropeptide Y
4	9606.ENSP00000290953	0.731	Agouti-related protein
5	9606.ENSP00000454804	0.684	Agouti-signaling protein
6	9606.ENSP00000382684	0.669	Melanocortin-2 receptor accessory protein
7	9606.ENSP00000358496	0.587	Cx9C motif-containing protein 4
8	9606.ENSP00000245185	0.566	Metallothionein-2
9	9606.ENSP00000345728	0.517	Copper-transporting ATPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.999	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0007188	0.958	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189	0.894	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007187	0.628	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0008152	0.423	metabolic process
GO:0044237	0.353	cellular metabolic process
GO:0048518	0.324	positive regulation of biological process
GO:0032501	0.307	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.818	intracellular anatomical structure
GO:0043226	0.585	organelle
GO:0043227	0.546	membrane-bounded organelle
GO:0005737	0.303	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]