StarFunc result for job id P33076

User Input

>input (1130 residues)
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVRPVSDCS
TLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGL
WQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGIL
VEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRG
CTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGAL
WLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCLGALLGPSAAA
SVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKL
EFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETL
NLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQ
YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A087X2I7	0.734	0.734	0.000	1131	0.998	0.997	A0A087X2I7.pdb.gz	A0A087X2I7_HUMAN Class II major histocompatibility complex transactivator OS=Homo sapiens OX=9606 GN=CIITA PE=1 SV=1
2	AFDB:G3V6C0	0.727	0.713	0.000	1153	0.696	0.682	G3V6C0.pdb.gz	G3V6C0_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=2
3	PDB:7pzcA	0.493	0.544	1.323E-22	1010	0.147	0.164	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
4	PDB:7lfhA	0.451	0.601	2.421E-21	806	0.145	0.203	7lfhA.pdb.gz
5	PDB:4kxfP	0.359	0.442	4.818E-19	866	0.115	0.150	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
6	PDB:6npyA	0.446	0.597	1.049E-17	798	0.143	0.203	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
7	PDB:3jblA	0.198	0.239	1.399E-12	909	0.105	0.131	3jblA.pdb.gz
8	PDB:6b5bA	0.204	0.195	1.456E-11	1199	0.120	0.113	6b5bA.pdb.gz
9	PDB:5yudA	0.198	0.184	1.574E-8	1238	0.115	0.105	5yudA.pdb.gz	Structural basis for specific flagellin recognition by the NLR protein NAIP5.
10	PDB:6j5wA	0.157	0.204	3.889E-6	816	0.065	0.091	6j5wA.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
11	PDB:1a4yA	0.169	0.334	1.102E-5	460	0.068	0.167	1a4yA.pdb.gz
12	AFDB:Q9Y794	0.169	0.192	1.676E-5	972	0.102	0.118	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
13	PDB:3sfzA	0.172	0.172	2.624E-5	1133	0.058	0.058	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
14	AFDB:F4IAE9	0.130	0.122	6.411E-4	1210	0.111	0.103	F4IAE9.pdb.gz	Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana OX=3702 GN=At1g05910 PE=2 SV=1
15	AFDB:Q9C0W2	0.127	0.122	8.317E-4	1201	0.101	0.095	Q9C0W2.pdb.gz	ATD22_SCHPO ATPase with bromodomain protein abo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo2 PE=3 SV=1
16	AFDB:Q0WLC6	0.096	0.099	1.079E-3	1089	0.122	0.127	Q0WLC6.pdb.gz	PP349_ARATH Pentatricopeptide repeat-containing protein MRL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MRL1 PE=1 SV=2
17	AFDB:Q9FNM7	0.085	0.101	4.517E-3	850	0.076	0.101	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
18	AFDB:A0A024R1Q0	0.067	0.067	1.173E-2	1141	0.150	0.148	A0A024R1Q0.pdb.gz
19	AFDB:P54816	0.133	0.119	1.810E-2	1291	0.116	0.101	P54816.pdb.gz	TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans OX=6239 GN=lex-1 PE=1 SV=3
20	AFDB:Q0WQK1	0.090	0.097	1.891E-2	961	0.116	0.136	Q0WQK1.pdb.gz	Q0WQK1_ARATH Uncharacterized protein At1g27595 OS=Arabidopsis thaliana OX=3702 GN=At1g27595 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X2I7	0.0	2278	1131	0.998	0.997	A0A087X2I7_HUMAN Class II major histocompatibility complex transactivator OS=Homo sapiens OX=9606 GN=CIITA PE=1 SV=1
2	A0A0B4J1S1	0.0	2283	1130	0.999	0.999	A0A0B4J1S1_HUMAN Class II major histocompatibility complex transactivator OS=Homo sapiens OX=9606 GN=CIITA PE=1 SV=1
3	A0A0G2JVN3	0.0	1522	1069	0.695	0.734	A0A0G2JVN3_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=2
4	A0A0G2K9Q5	0.0	1537	1073	0.704	0.741	A0A0G2K9Q5_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=1
5	A0A8I5ZK58	0.0	1511	1072	0.691	0.729	A0A8I5ZK58_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=1
6	G3V6C0	0.0	1512	1156	0.691	0.676	G3V6C0_RAT Class II, major histocompatibility complex, transactivator OS=Rattus norvegicus OX=10116 GN=Ciita PE=4 SV=2
7	P33076	0.0	2286	1130	1.000	1.000	C2TA_HUMAN MHC class II transactivator OS=Homo sapiens OX=9606 GN=CIITA PE=1 SV=3
8	P79621	0.0	1533	1155	0.697	0.682	C2TA_MOUSE MHC class II transactivator OS=Mus musculus OX=10090 GN=Ciita PE=1 SV=2
9	Q29704	0.0	690	353	0.296	0.946	Q29704_HUMAN Class II MHC mutant RJ2.2.5 OS=Homo sapiens OX=9606 GN=CIITA PE=2 SV=1
10	Q9GJD8	0.0	1512	1052	0.691	0.742	Q9GJD8_RAT MHC class II transactivator type IV OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1
11	Q9GJD9	0.0	1536	1073	0.704	0.741	Q9GJD9_RAT MHC class II transactivator type III OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1
12	Q9GJE0	0.0	1521	1153	0.693	0.679	Q9GJE0_RAT MHC class II transactivator type I OS=Rattus norvegicus OX=10116 GN=Ciita PE=2 SV=1
13	Q80SY9	1.65e-32	139	1013	0.177	0.197	Q80SY9_MOUSE NOD2 OS=Mus musculus OX=10090 GN=Nod2 PE=2 SV=1
14	Q8K3Z0	1.71e-32	139	1020	0.177	0.196	NOD2_MOUSE Nucleotide-binding oligomerization domain-containing protein 2 OS=Mus musculus OX=10090 GN=Nod2 PE=1 SV=1
15	A0A0G2K4Z7	6.46e-31	134	1034	0.191	0.209	A0A0G2K4Z7_RAT Nucleotide-binding oligomerization domain containing 2 OS=Rattus norvegicus OX=10116 GN=Nod2 PE=3 SV=2
16	Q6E804	1.67e-28	126	1013	0.185	0.206	NOD2_BOVIN Nucleotide-binding oligomerization domain-containing protein 2 OS=Bos taurus OX=9913 GN=NOD2 PE=2 SV=1
17	C3VPR6	2.26e-28	126	1915	0.148	0.087	NLRC5_MOUSE Protein NLRC5 OS=Mus musculus OX=10090 GN=Nlrc5 PE=1 SV=2
18	Q86WI3	5.58e-27	122	1866	0.137	0.083	NLRC5_HUMAN Protein NLRC5 OS=Homo sapiens OX=9606 GN=NLRC5 PE=1 SV=3
19	E9Q5R7	6.64e-25	114	1054	0.175	0.188	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
20	Q9Y239	6.83e-25	114	953	0.165	0.195	NOD1_HUMAN Nucleotide-binding oligomerization domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NOD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	61	15.5	Leucine Rich Repeat
2	PF12799 LRR_4	0.24	23.1	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	1.7e-10	51.1	Leucine Rich repeat
4	PF13855 LRR_8	0.2	22.8	Leucine rich repeat
5	PF14580 LRR_9	1.4e+02	13.4	Leucine-rich repeat
6	PF05729 NACHT	6.5e-42	154.8	NACHT domain
7	PF17776 NLRC4_HD2	0.002	30.2	NLRC4 helical domain HD2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485010

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290524	0.999	DNA-binding protein RFX5
2	9606.ENSP00000387699	0.988	Cyclic AMP-responsive element-binding protein 1
3	9606.ENSP00000305071	0.983	DNA-binding protein RFXANK
4	9606.ENSP00000255476	0.951	Regulatory factor X-associated protein
5	9606.ENSP00000240055	0.948	Nuclear transcription factor Y subunit beta
6	9606.ENSP00000254325	0.922	MHC class II regulatory factor RFX1
7	9606.ENSP00000354394	0.913	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000374359	0.906	Zinc finger protein ZXDC
9	9606.ENSP00000345702	0.903	Nuclear transcription factor Y subunit alpha
10	9606.ENSP00000430432	0.857	Histone deacetylase 2
11	9606.ENSP00000261900	0.837	Cyclin-T1
12	9606.ENSP00000305422	0.831	CCAAT/enhancer-binding protein beta
13	9606.ENSP00000384863	0.822	Exportin-1
14	9606.ENSP00000428657	0.804	Baculoviral IAP repeat-containing protein 1
15	9606.ENSP00000351530	0.803	Zinc finger X-linked protein ZXDA
16	9606.ENSP00000284000	0.800	CCAAT/enhancer-binding protein gamma
17	9606.ENSP00000369131	0.769	Paired amphipathic helix protein Sin3b
18	9606.ENSP00000310572	0.763	26S proteasome regulatory subunit 8
19	9606.ENSP00000375942	0.750	TATA-box-binding protein
20	9606.ENSP00000262367	0.748	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:1901363	0.968	heterocyclic compound binding
GO:0097159	0.968	organic cyclic compound binding
GO:0003676	0.759	nucleic acid binding
GO:0003677	0.524	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045892	0.995	negative regulation of DNA-templated transcription
GO:0034341	0.992	response to type II interferon
GO:0048522	0.991	positive regulation of cellular process
GO:0009987	0.986	cellular process
GO:0006357	0.986	regulation of transcription by RNA polymerase II
GO:0045893	0.980	positive regulation of DNA-templated transcription
GO:0045944	0.971	positive regulation of transcription by RNA polymerase II
GO:0051716	0.964	cellular response to stimulus
GO:0000122	0.943	negative regulation of transcription by RNA polymerase II
GO:0104004	0.874	cellular response to environmental stimulus
GO:0071310	0.855	cellular response to organic substance
GO:0032502	0.848	developmental process
GO:0071345	0.808	cellular response to cytokine stimulus
GO:0071346	0.747	cellular response to type II interferon
GO:0006954	0.741	inflammatory response
GO:0071214	0.683	cellular response to abiotic stimulus
GO:0051602	0.655	response to electrical stimulus
GO:1901698	0.599	response to nitrogen compound
GO:0043330	0.587	response to exogenous dsRNA
GO:0071407	0.540	cellular response to organic cyclic compound
GO:0007568	0.538	aging

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005829	0.989	cytosol
GO:0032991	0.529	protein-containing complex
GO:0016020	0.414	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]