StarFunc result for job id P33240

User Input

>input (577 residues)
MAGLTVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYG
FCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGTGAPVIESPYGETIS
PEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMR
IVDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQAQSLGGMHVN
GAPPLMQASMQGGVPAPGQMPAAVTGPGPGSLAPGGGMQAQVGMPGSGPVSMERGQVPMQ
DPRAAMQRGSLPANVPTPRGLLGDAPNDPRGGTLLSVTGEVEPRGYLGPPHQGPPMHHVP
GHESRGPPPHELRGGPLPEPRPLMAEPRGPMLDQRGPPLDGRGGRDPRGIDARGMEARAM
EARGLDARGLEARAMEARAMEARAMEARAMEARAMEVRGMEARGMDTRGPVPGPRGPIPS
GMQGPSPINMGAVVPQGSRQVPVMQGTGMQGASIQGGSQPGGFSPGQNQVTPQDHEKAAL
IMQVLQLTADQIAMLPPEQRQSILILKEQIQKSTGAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33240	0.999	0.999	9.818E-78	577	1.000	1.000	P33240.pdb.gz	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
2	AFDB:E7EWR4	0.219	0.214	2.238E-71	597	1.000	0.966	E7EWR4.pdb.gz	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
3	AFDB:A0A0G2K6F9	0.348	0.349	1.376E-65	575	0.931	0.934	A0A0G2K6F9.pdb.gz	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
4	AFDB:Q8C7E9	0.174	0.159	1.975E-54	632	0.745	0.680	Q8C7E9.pdb.gz	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
5	AFDB:Q9VE52	0.199	0.264	1.282E-29	419	0.386	0.532	Q9VE52.pdb.gz	Q9VE52_DROME Cleavage stimulation factor 64 kD subunit OS=Drosophila melanogaster OX=7227 GN=CstF64 PE=1 SV=2
6	PDB:6qx91K	0.138	0.391	1.391E-8	201	0.054	0.154	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
7	AFDB:F4JFN7	0.141	0.163	3.810E-8	495	0.172	0.200	F4JFN7.pdb.gz	F4JFN7_ARATH RNA-binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07810 PE=1 SV=1
8	PDB:3lqvB	0.133	0.600	4.870E-8	115	0.054	0.270	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	AFDB:A6NDE4	0.149	0.171	5.676E-8	496	0.149	0.173	A6NDE4.pdb.gz	RBY1B_HUMAN RNA-binding motif protein, Y chromosome, family 1 member B OS=Homo sapiens OX=9606 GN=RBMY1B PE=2 SV=2
10	PDB:7dvqY	0.142	0.556	7.255E-8	140	0.062	0.257	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
11	PDB:5gm6V	0.129	0.564	1.282E-7	128	0.057	0.258	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:6y53o	0.133	0.471	2.400E-7	160	0.047	0.169	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
13	AFDB:Q1LY77	0.154	0.050	3.319E-7	1844	0.156	0.049	Q1LY77.pdb.gz	SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2
14	AFDB:E9PYH6	0.150	0.053	3.937E-7	1716	0.168	0.057	E9PYH6.pdb.gz	SET1A_MOUSE Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1
15	PDB:5yzg1	0.132	0.309	4.242E-7	243	0.043	0.103	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
16	AFDB:F4J5A7	0.149	0.092	6.574E-7	987	0.180	0.105	F4J5A7.pdb.gz	F4J5A7_ARATH RNA recognition motif (RRM)-containing protein OS=Arabidopsis thaliana OX=3702 GN=At3g23900 PE=1 SV=1
17	PDB:5oobB	0.134	0.486	6.690E-7	152	0.045	0.171	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
18	PDB:5xjcw	0.126	0.757	8.403E-7	91	0.052	0.330	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
19	PDB:6gd1A	0.127	0.376	1.403E-6	190	0.040	0.121	6gd1A.pdb.gz
20	PDB:7ohxo	0.130	0.616	1.485E-6	112	0.042	0.214	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JWP1	0.0	940	569	0.894	0.907	A0A0G2JWP1_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
2	A0A0G2K6F9	0.0	786	478	0.761	0.918	A0A0G2K6F9_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=2
3	A0A8I5ZY65	0.0	935	549	0.889	0.934	A0A8I5ZY65_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
4	A0A8J8XR33	0.0	975	624	0.931	0.861	A0A8J8XR33_RAT Cleavage stimulation factor, 3' pre-RNA subunit 2 OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
5	B4F7F1	0.0	998	575	0.932	0.936	B4F7F1_RAT Cstf2 protein OS=Rattus norvegicus OX=10116 GN=Cstf2 PE=1 SV=1
6	E7EWR4	0.0	1123	597	1.000	0.966	E7EWR4_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
7	P33240	0.0	1135	577	1.000	1.000	CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1
8	Q8C7E9	0.0	710	632	0.745	0.680	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
9	Q9H0L4	0.0	768	616	0.759	0.711	CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1
10	Q9VE52	3.21e-90	286	419	0.239	0.329	Q9VE52_DROME Cleavage stimulation factor 64 kD subunit OS=Drosophila melanogaster OX=7227 GN=CstF64 PE=1 SV=2
11	O45577	6.33e-63	212	336	0.184	0.315	O45577_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cpf-2 PE=1 SV=1
12	Q9M9G6	6.03e-40	153	461	0.232	0.291	CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana OX=3702 GN=CSTF64 PE=1 SV=1
13	Q9P6P7	3.36e-27	116	422	0.125	0.171	YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC644.16 PE=4 SV=1
14	O43040	1.80e-20	95.5	363	0.071	0.113	CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf1 PE=1 SV=1
15	O45713	1.75e-18	82.4	85	0.064	0.435	O45713_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbm-3.2 PE=1 SV=1
16	P25299	4.24e-18	87.4	296	0.061	0.118	RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNA15 PE=1 SV=1
17	Q9Y388	9.45e-15	77.8	322	0.061	0.109	RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens OX=9606 GN=RBMX2 PE=1 SV=2
18	Q57WI8	5.05e-14	75.9	340	0.061	0.103	Q57WI8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.110 PE=4 SV=1
19	Q9VIS0	5.81e-14	71.6	154	0.062	0.234	Q9VIS0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=cg10466 PE=4 SV=1
20	Q4QRG7	2.01e-13	74.7	434	0.057	0.076	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14327 CSTF2_hinge	1.8e-25	100.5	Hinge domain of cleavage stimulation factor subunit 2
2	PF14304 CSTF_C	9.8e-14	62.0	Transcription termination and cleavage factor C-terminal
3	PF00076 RRM_1	5e-22	88.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	39	15.8	RNA recognition motif
5	PF16842 RRM_occluded	4.1e+02	12.3	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217109	0.999	Cleavage stimulation factor subunit 1
2	9606.ENSP00000238112	0.999	Cleavage and polyadenylation specificity factor subunit 3
3	9606.ENSP00000245934	0.999	Symplekin
4	9606.ENSP00000298875	0.999	Cleavage and polyadenylation specificity factor subunit 2
5	9606.ENSP00000315791	0.999	Cleavage stimulation factor subunit 3
6	9606.ENSP00000484669	0.998	Cleavage and polyadenylation specificity factor subunit 1
7	9606.ENSP00000292476	0.993	Cleavage and polyadenylation specificity factor subunit 4
8	9606.ENSP00000216277	0.990	Poly(A) polymerase alpha
9	9606.ENSP00000298281	0.988	Pre-mRNA cleavage complex 2 protein Pcf11
10	9606.ENSP00000300291	0.988	Cleavage and polyadenylation specificity factor subunit 5
11	9606.ENSP00000266679	0.986	Cleavage and polyadenylation specificity factor subunit 6
12	9606.ENSP00000336752	0.984	Pre-mRNA 3'-end-processing factor FIP1
13	9606.ENSP00000434995	0.979	Polyribonucleotide 5'-hydroxyl-kinase Clp1
14	9606.ENSP00000291386	0.977	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
15	9606.ENSP00000325377	0.977	pre-mRNA 3' end processing protein WDR33
16	9606.ENSP00000332444	0.975	Cleavage stimulation factor subunit 2 tau variant
17	9606.ENSP00000345412	0.969	Cleavage and polyadenylation specificity factor subunit 7
18	9606.ENSP00000265073	0.910	Activated RNA polymerase II transcriptional coactivator p15
19	9606.ENSP00000356257	0.907	Leiomodin-1
20	9606.ENSP00000384700	0.906	poly(A) polymerase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990089	0.995	response to nerve growth factor
GO:1990090	0.992	cellular response to nerve growth factor stimulus
GO:0071704	0.682	organic substance metabolic process
GO:0009987	0.673	cellular process
GO:0044238	0.658	primary metabolic process
GO:0044237	0.651	cellular metabolic process
GO:0006807	0.642	nitrogen compound metabolic process
GO:0043170	0.634	macromolecule metabolic process
GO:0006139	0.615	nucleobase-containing compound metabolic process
GO:0090304	0.603	nucleic acid metabolic process
GO:0016070	0.577	RNA metabolic process
GO:0010467	0.555	gene expression
GO:0006397	0.546	mRNA processing
GO:0050789	0.367	regulation of biological process
GO:0050794	0.325	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0016604	0.990	nuclear body
GO:0140513	0.937	nuclear protein-containing complex
GO:0005737	0.562	cytoplasm
GO:0005849	0.454	mRNA cleavage factor complex
GO:0005847	0.391	mRNA cleavage and polyadenylation specificity factor complex
GO:0071920	0.385	cleavage body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]