StarFunc result for job id P33260

User Input

>input (490 residues)
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKV
YGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRW
KEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICS
VIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYI
KSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTE
TTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYID
LLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFK
KSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVP
PLYQLCFIPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33260	1.000	1.000	2.241E-78	490	1.000	1.000	P33260.pdb.gz	CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens OX=9606 GN=CYP2C18 PE=1 SV=3
2	AFDB:Q64458	0.996	0.996	5.349E-66	490	0.765	0.765	Q64458.pdb.gz	CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus OX=10090 GN=Cyp2c29 PE=1 SV=2
3	AFDB:P11712	0.987	0.987	6.737E-66	490	0.818	0.818	P11712.pdb.gz	CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens OX=9606 GN=CYP2C9 PE=1 SV=3
4	AFDB:P05178	0.995	0.995	8.884E-66	490	0.771	0.771	P05178.pdb.gz	CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus OX=10116 GN=Cyp2c6 PE=2 SV=2
5	AFDB:Q9D816	0.996	0.996	1.345E-65	490	0.761	0.761	Q9D816.pdb.gz	CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus OX=10090 GN=Cyp2c55 PE=1 SV=1
6	AFDB:P05179	0.993	0.993	1.350E-64	490	0.710	0.710	P05179.pdb.gz	CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus OX=10116 GN=Cyp2c7 PE=1 SV=2
7	AFDB:P08683	0.988	0.968	1.700E-64	500	0.771	0.756	P08683.pdb.gz	CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus OX=10116 GN=Cyp2c11 PE=1 SV=1
8	AFDB:Q5GLZ0	0.993	0.993	5.159E-63	490	0.749	0.749	Q5GLZ0.pdb.gz	Q5GLZ0_MOUSE Cytochrome P450 2C66 OS=Mus musculus OX=10090 GN=Cyp2c66 PE=1 SV=1
9	AFDB:P10632	0.980	0.980	6.804E-63	490	0.771	0.771	P10632.pdb.gz	CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens OX=9606 GN=CYP2C8 PE=1 SV=2
10	AFDB:P56655	0.989	0.989	1.490E-62	490	0.743	0.743	P56655.pdb.gz	CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus OX=10090 GN=Cyp2c38 PE=1 SV=2
11	PDB:4nz2A	0.913	0.963	8.472E-57	464	0.773	0.817	4nz2A.pdb.gz	Structure-based ligand design to overcome CYP inhibition in drug discovery projects.
12	PDB:4gqsA	0.909	0.958	3.082E-56	464	0.761	0.804	4gqsA.pdb.gz	Structural Characterization of Human Cytochrome P450 2C19: ACTIVE SITE DIFFERENCES BETWEEN P450s 2C8, 2C9, AND 2C19.
13	PDB:2vn0A	0.910	0.960	2.571E-55	464	0.737	0.778	2vn0A.pdb.gz	Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid.
14	PDB:3t3zA	0.928	0.980	2.876E-49	464	0.549	0.580	3t3zA.pdb.gz	Structural comparison of cytochromes P450 2A6, 2A13, and 2E1 with pilocarpine.
15	PDB:1z11A	0.931	0.977	2.631E-48	467	0.471	0.495	1z11A.pdb.gz	Structures of human microsomal cytochrome P450 2A6 complexed with coumarin and methoxsalen
16	PDB:4i91A	0.928	0.977	1.384E-47	465	0.461	0.486	4i91A.pdb.gz	Structural and Thermodynamic Basis of (+)-alpha-Pinene Binding to Human Cytochrome P450 2B6.
17	PDB:3tbgA	0.869	0.910	3.587E-38	467	0.382	0.400	3tbgA.pdb.gz	Contributions of Ionic Interactions and Protein Dynamics to Cytochrome P450 2D6 (CYP2D6) Substrate and Inhibitor Binding.
18	PDB:3c6gB	0.895	0.938	7.236E-35	467	0.337	0.353	3c6gB.pdb.gz	Structural analysis of CYP2R1 in complex with vitamin D3.
19	PDB:6b82B	0.866	0.901	1.687E-29	470	0.278	0.289	6b82B.pdb.gz	Inherent steroid 17 alpha ,20-lyase activity in defunct cytochrome P450 17A enzymes.
20	PDB:6cizC	0.847	0.870	2.802E-29	477	0.257	0.264	6cizC.pdb.gz	Structure-Based Design of Inhibitors with Improved Selectivity for Steroidogenic Cytochrome P450 17A1 over Cytochrome P450 21A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B7Z1F5	690	420	0.663	0.774	B7Z1F5_HUMAN Cytochrome P450 family 2 subfamily C member 8 OS=Homo sapiens OX=9606 GN=CYP2C8 PE=1 SV=1
2	O35293	556	491	0.520	0.519	CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus OX=10116 GN=Cyp2f2 PE=2 SV=1
3	P00180	781	490	0.763	0.763	CP2C1_RABIT Cytochrome P450 2C1 OS=Oryctolagus cuniculus OX=9986 GN=CYP2C1 PE=1 SV=2
4	P00181	754	490	0.710	0.710	CP2C2_RABIT Cytochrome P450 2C2 OS=Oryctolagus cuniculus OX=9986 GN=CYP2C2 PE=1 SV=2
5	P05178	762	490	0.771	0.771	CP2C6_RAT Cytochrome P450 2C6 OS=Rattus norvegicus OX=10116 GN=Cyp2c6 PE=2 SV=2
6	P05179	749	490	0.686	0.686	CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus OX=10116 GN=Cyp2c7 PE=1 SV=2
7	P05180	550	491	0.563	0.562	CP2H1_CHICK Cytochrome P450 2H1 OS=Gallus gallus OX=9031 GN=CYP2H1 PE=2 SV=1
8	P05181	607	493	0.569	0.566	CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens OX=9606 GN=CYP2E1 PE=1 SV=1
9	P05182	604	493	0.569	0.566	CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus OX=10116 GN=Cyp2e1 PE=1 SV=4
10	P08683	786	500	0.771	0.756	CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus OX=10116 GN=Cyp2c11 PE=1 SV=1
11	P10610	532	494	0.506	0.502	CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus OX=10116 GN=Cyp2g1 PE=2 SV=1
12	P10632	798	490	0.771	0.771	CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens OX=9606 GN=CYP2C8 PE=1 SV=2
13	P11712	830	490	0.788	0.788	CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens OX=9606 GN=CYP2C9 PE=1 SV=3
14	P15392	524	494	0.510	0.506	CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus OX=10090 GN=Cyp2a4 PE=2 SV=3
15	P19225	639	489	0.616	0.618	CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus OX=10116 GN=Cyp2c70 PE=2 SV=1
16	P20814	697	490	0.682	0.682	CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus OX=10116 GN=Cyp2c13 PE=1 SV=1
17	P20852	519	494	0.502	0.498	CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus OX=10090 GN=Cyp2a5 PE=2 SV=1
18	P24470	631	494	0.610	0.605	CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus OX=10116 GN=Cyp2c23 PE=1 SV=2
19	P33260	1018	490	1.000	1.000	CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens OX=9606 GN=CYP2C18 PE=1 SV=3
20	P33261	827	490	0.808	0.808	CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens OX=9606 GN=CYP2C19 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00067 p450	6.2e-160	544.6	Cytochrome P450

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000285979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480004	0.948	Epoxide hydrolase 1
2	9606.ENSP00000369050	0.924	Cytochrome P450 1A1
3	9606.ENSP00000363832	0.902	Aldehyde oxidase
4	9606.ENSP00000304845	0.856	UDP-glucuronosyltransferase 1-1
5	9606.ENSP00000337915	0.848	Cytochrome P450 3A4
6	9606.ENSP00000260970	0.840	Peptidyl-prolyl cis-trans isomerase G
7	9606.ENSP00000362549	0.840	UDP-glucuronosyltransferase 1-8
8	9606.ENSP00000303174	0.835	UDP-glucuronosyltransferase 1-6
9	9606.ENSP00000360958	0.824	Cytochrome P450 4A22
10	9606.ENSP00000222982	0.820	Cytochrome P450 3A5
11	9606.ENSP00000311095	0.820	Cytochrome P450 4A11
12	9606.ENSP00000304811	0.817	UDP-glucuronosyltransferase 2B7
13	9606.ENSP00000480571	0.817	Cytochrome P450 3A7
14	9606.ENSP00000418532	0.804	UDP-glucuronosyltransferase 1-3
15	9606.ENSP00000362508	0.793	UDP-glucuronosyltransferase 1-4
16	9606.ENSP00000320401	0.791	UDP-glucuronosyltransferase 2B17
17	9606.ENSP00000305221	0.785	UDP-glucuronosyltransferase 2B4
18	9606.ENSP00000346768	0.777	UDP-glucuronosyltransferase 1-9
19	9606.ENSP00000362513	0.776	UDP-glucuronosyltransferase 1-5
20	9606.ENSP00000251566	0.766	UDP-glucuronosyltransferase 2A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016705	1.000	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004497	1.000	monooxygenase activity
GO:0005488	0.976	binding
GO:0005515	0.642	protein binding
GO:0036094	0.446	small molecule binding
GO:0016709	0.402	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen
GO:0008395	0.349	steroid hydroxylase activity
GO:0008391	0.304	arachidonic acid monooxygenase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006629	0.984	lipid metabolic process
GO:0044281	0.978	small molecule metabolic process
GO:0019752	0.970	carboxylic acid metabolic process
GO:0032787	0.960	monocarboxylic acid metabolic process
GO:0050896	0.948	response to stimulus
GO:0044255	0.941	cellular lipid metabolic process
GO:0042221	0.884	response to chemical
GO:0001676	0.861	long-chain fatty acid metabolic process
GO:0006690	0.860	icosanoid metabolic process
GO:0033559	0.860	unsaturated fatty acid metabolic process
GO:0120254	0.854	olefinic compound metabolic process
GO:0009410	0.717	response to xenobiotic stimulus
GO:0019369	0.707	arachidonic acid metabolic process
GO:0051716	0.594	cellular response to stimulus
GO:0070887	0.511	cellular response to chemical stimulus
GO:0071466	0.491	cellular response to xenobiotic stimulus
GO:0006805	0.484	xenobiotic metabolic process
GO:0065007	0.447	biological regulation
GO:1901360	0.342	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	0.996	endoplasmic reticulum
GO:0005789	0.967	endoplasmic reticulum membrane
GO:0071944	0.919	cell periphery
GO:0005886	0.874	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.-.-	1.000	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
EC:1.14.13.-	0.402	With NADH or NADPH as one donor, and incorporation of one atom of oxygen.
RHEA:43836	0.349	cholesterol + H(+) + NADPH + O2 = 26-hydroxycholesterol + H2O + NADP(+)

[back to server]