StarFunc result for job id P33316

User Input

>input (252 residues)
MTPLCPRPALCYHFLTSLLRSAMQNARGARQRAEAAVLSGPGPPLGRAAQHGIPRPLSSA
GRLSQGCRGASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLS
EHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKH
FIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTE
RGSGGFGSTGKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33316	1.000	1.000	1.991E-42	252	1.000	1.000	P33316.pdb.gz	DUT_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4
2	AFDB:H0YKC5	0.554	0.631	1.241E-35	221	0.873	0.995	H0YKC5.pdb.gz	H0YKC5_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase (Fragment) OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=1
3	AFDB:P70583	0.563	0.691	1.530E-27	205	0.575	0.707	P70583.pdb.gz	DUT_RAT Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Rattus norvegicus OX=10116 GN=Dut PE=2 SV=3
4	AFDB:Q9V3I1	0.566	0.753	2.028E-21	188	0.381	0.511	Q9V3I1.pdb.gz	Q9V3I1_DROME Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Drosophila melanogaster OX=7227 GN=dUTPase PE=1 SV=1
5	AFDB:Q54BW5	0.573	0.800	1.657E-20	179	0.333	0.469	Q54BW5.pdb.gz	DUT_DICDI Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=dut PE=1 SV=1
6	AFDB:Q9STG6	0.560	0.844	1.994E-19	166	0.345	0.524	Q9STG6.pdb.gz	DUT_ARATH Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Arabidopsis thaliana OX=3702 GN=DUT PE=1 SV=1
7	AFDB:P0CY19	0.555	0.877	2.108E-19	159	0.337	0.535	P0CY19.pdb.gz	DUT_CANAL Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DUT1 PE=3 SV=1
8	AFDB:P33317	0.561	0.958	4.324E-19	147	0.302	0.517	P33317.pdb.gz	DUT_YEAST Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DUT1 PE=1 SV=2
9	AFDB:Q9P6Q5	0.553	0.993	7.112E-19	140	0.325	0.586	Q9P6Q5.pdb.gz	DUT_SCHPO Probable deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC644.05c PE=3 SV=1
10	PDB:4oopB	0.548	0.967	1.102E-18	142	0.337	0.599	4oopB.pdb.gz	Structural insights into the mechanism defining substrate affinity in Arabidopsis thaliana dUTPase: the role of tryptophan 93 in ligand orientation.
11	AFDB:B4LTG5	0.565	0.282	7.663E-18	510	0.405	0.200	B4LTG5.pdb.gz	B4LTG5_DROVI Deoxyuridine triphosphatase OS=Drosophila virilis OX=7244 GN=Dvir\dUTPase PE=1 SV=1
12	PDB:3f4fA	0.535	0.971	1.255E-17	138	0.290	0.529	3f4fA.pdb.gz	Structure and activity of the Saccharomyces cerevisiae dUTP pyrophosphatase DUT1, an essential housekeeping enzyme.
13	PDB:4gcyA	0.542	0.828	1.514E-13	163	0.230	0.356	4gcyA.pdb.gz	RAMD identification of substrate binding pathways to the active site of dUTPase
14	PDB:6hdeB	0.523	0.847	1.069E-11	152	0.183	0.303	6hdeB.pdb.gz	The Role of a Key Amino Acid Position in Species-Specific Proteinaceous dUTPase Inhibition.
15	PDB:4ao5B	0.435	0.803	3.237E-8	129	0.135	0.264	4ao5B.pdb.gz	Tying Down the Arm in Bacillus Dutpase: Structure and Mechanism
16	PDB:3t64A	0.349	0.555	1.468E-6	153	0.159	0.261	3t64A.pdb.gz	Design, synthesis, and evaluation of 5'-diphenyl nucleoside analogues as inhibitors of the Plasmodium falciparum dUTPase.
17	PDB:2y8cC	0.365	0.652	4.688E-6	136	0.163	0.301	2y8cC.pdb.gz	Beta-Branched Acyclic Nucleoside Analogues as Inhibitors of Plasmodium Falciparum Dutpase
18	PDB:4a6aA	0.308	0.401	4.780E-5	189	0.095	0.127	4a6aA.pdb.gz	Dttp Inhibition of the Bifunctional Dctp Deaminase- Dutpase from Mycobacterium Tuberculosis is Ph Dependent: Kinetic Analyses and Crystal Structure of A115V Variant
19	PDB:2v9xA	0.312	0.399	5.339E-5	193	0.099	0.130	2v9xA.pdb.gz	Mutational Analysis of the Nucleotide Binding Site of Escherichia Coli Dctp Deaminase.
20	PDB:5fl1A	0.192	0.085	5.457E-1	703	0.067	0.024	5fl1A.pdb.gz	Analysis of transition state mimicry by tight binding aminothiazoline inhibitors provides insight into catalysis by humanO-GlcNAcase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33316	0.0	510	252	1.000	1.000	DUT_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=4
2	H0YKC5	4.78e-156	434	221	0.873	0.995	H0YKC5_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase (Fragment) OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=1
3	H0YNW5	5.80e-115	328	167	0.635	0.958	H0YNW5_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=1
4	A0A0C4DGL3	5.84e-101	291	141	0.560	1.000	A0A0C4DGL3_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=1
5	Q9CQ43	4.42e-97	283	162	0.544	0.846	DUT_MOUSE Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Mus musculus OX=10090 GN=Dut PE=1 SV=1
6	P70583	1.52e-96	283	205	0.544	0.668	DUT_RAT Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Rattus norvegicus OX=10116 GN=Dut PE=2 SV=3
7	H0YMP1	1.19e-67	206	107	0.393	0.925	H0YMP1_HUMAN Deoxyuridine 5'-triphosphate nucleotidohydrolase (Fragment) OS=Homo sapiens OX=9606 GN=DUT PE=1 SV=1
8	Q9V3I1	2.48e-65	203	188	0.381	0.511	Q9V3I1_DROME Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Drosophila melanogaster OX=7227 GN=dUTPase PE=1 SV=1
9	B4LTG5	3.27e-65	213	510	0.440	0.218	B4LTG5_DROVI Deoxyuridine triphosphatase OS=Drosophila virilis OX=7244 GN=Dvir\dUTPase PE=1 SV=1
10	Q8IPB1	4.54e-65	202	174	0.377	0.546	Q8IPB1_DROME Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Drosophila melanogaster OX=7227 GN=dUTPase PE=1 SV=1
11	Q9STG6	7.67e-53	170	166	0.337	0.512	DUT_ARATH Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Arabidopsis thaliana OX=3702 GN=DUT PE=1 SV=1
12	Q54BW5	2.00e-52	170	179	0.333	0.469	DUT_DICDI Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=dut PE=1 SV=1
13	P0CY19	1.83e-51	167	159	0.329	0.522	DUT_CANAL Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DUT1 PE=3 SV=1
14	Q9P6Q5	1.73e-50	163	140	0.325	0.586	DUT_SCHPO Probable deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC644.05c PE=3 SV=1
15	P33317	7.01e-47	154	147	0.310	0.531	DUT_YEAST Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DUT1 PE=1 SV=2
16	P9WNS5	5.21e-20	85.5	154	0.210	0.344	DUT_MYCTU Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=dut PE=1 SV=1
17	P06968	9.43e-18	79.7	152	0.198	0.329	DUT_ECOLI Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=dut PE=1 SV=2
18	P11204	8.73e-15	75.9	1146	0.167	0.037	POL_EIAV9 Pol polyprotein OS=Equine infectious anemia virus (isolate 1369) OX=11670 GN=pol PE=1 SV=1
19	O48500	5.96e-13	66.6	148	0.147	0.250	DUT_BPT5 Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Escherichia phage T5 OX=2695836 GN=DUT PE=1 SV=1
20	Q8II92	5.92e-08	53.1	173	0.115	0.168	Q8II92_PLAF7 Deoxyuridine 5'-triphosphate nucleotidohydrolase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1127100 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00692 dUTPase	9.7e-48	172.5	dUTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370376

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315644	0.998	Thymidylate synthase
2	9606.ENSP00000304802	0.991	Thymidylate kinase
3	9606.ENSP00000349576	0.986	Deoxycytidylate deaminase
4	9606.ENSP00000299697	0.979	Thymidine kinase 2, mitochondrial
5	9606.ENSP00000385523	0.978	Peroxisome proliferator-activated receptor alpha
6	9606.ENSP00000300738	0.974	Ribonucleoside-diphosphate reductase large subunit
7	9606.ENSP00000301634	0.970	Thymidine kinase, cytosolic
8	9606.ENSP00000368458	0.965	Proliferating cell nuclear antigen
9	9606.ENSP00000242576	0.958	Uracil-DNA glycosylase
10	9606.ENSP00000369411	0.951	Replication factor C subunit 3
11	9606.ENSP00000378699	0.950	Cyclin-dependent kinase 1
12	9606.ENSP00000262105	0.946	DNA replication licensing factor MCM4
13	9606.ENSP00000216122	0.945	DNA replication licensing factor MCM5
14	9606.ENSP00000245552	0.941	5'(3')-deoxyribonucleotidase, cytosolic type
15	9606.ENSP00000416658	0.938	Nucleoside diphosphate kinase 6
16	9606.ENSP00000257770	0.936	5'-nucleotidase
17	9606.ENSP00000337060	0.935	Nucleoside diphosphate kinase A
18	9606.ENSP00000265056	0.934	DNA replication licensing factor MCM2
19	9606.ENSP00000221486	0.933	Ribonuclease H2 subunit A
20	9606.ENSP00000307288	0.932	DNA replication licensing factor MCM7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004170	0.998	dUTP diphosphatase activity
GO:0003676	0.997	nucleic acid binding
GO:0003723	0.994	RNA binding
GO:0042802	0.544	identical protein binding
GO:0043167	0.498	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0044281	0.995	small molecule metabolic process
GO:0009162	0.992	deoxyribonucleoside monophosphate metabolic process
GO:0009129	0.992	pyrimidine nucleoside monophosphate metabolic process
GO:0009124	0.991	nucleoside monophosphate biosynthetic process
GO:0009265	0.991	2'-deoxyribonucleotide biosynthetic process
GO:0072528	0.990	pyrimidine-containing compound biosynthetic process
GO:0009219	0.990	pyrimidine deoxyribonucleotide metabolic process
GO:0044260	0.984	cellular macromolecule metabolic process
GO:0006259	0.971	DNA metabolic process
GO:0006221	0.965	pyrimidine nucleotide biosynthetic process
GO:0006260	0.916	DNA replication
GO:0065007	0.515	biological regulation
GO:0050789	0.509	regulation of biological process
GO:0050794	0.428	regulation of cellular process
GO:0050896	0.406	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.925	cytosol
GO:0005739	0.869	mitochondrion
GO:0005576	0.694	extracellular region
GO:0031982	0.615	vesicle
GO:0065010	0.531	extracellular membrane-bounded organelle
GO:0070062	0.446	extracellular exosome
GO:0043232	0.370	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10248	0.998	dUTP + H2O = diphosphate + dUMP + H(+)
EC:3.6.1.23	0.998	dUTP diphosphatase.

[back to server]