StarFunc result for job id P33527

User Input

>input (1531 residues)
MALRGFCSADGSDPLWDWNVTWNTSNPDFTKCFQNTVLVWVPCFYLWACFPFYFLYLSRH
DRGYIQMTPLNKTKTALGFLLWIVCWADLFYSFWERSRGIFLAPVFLVSPTLLGITMLLA
TFLIQLERRKGVQSSGIMLTFWLVALVCALAILRSKIMTALKEDAQVDLFRDITFYVYFS
LLLIQLVLSCFSDRSPLFSETIHDPNPCPESSASFLSRITFWWITGLIVRGYRQPLEGSD
LWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEAL
IVKSPQKEWNPSLFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAPD
WQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTV
GEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVN
AVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLK
KSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILP
MVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPT
LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQND
SLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLAR
AVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIV
MSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGM
LVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL
SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTDDPIVNGTQEHTKVRLSVYG
ALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKEL
DTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQL
KRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLA
VRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVA
VERLKEYSETEKEAPWQIQETAPPSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGG
EKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLF
SGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCL
ARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVL
DKGEIQEYGAPSDLLQQRGLFYSMAKDAGLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mpeA	0.766	0.816	0.000	1428	0.387	0.415	7mpeA.pdb.gz
2	AFDB:A0A0R4IC81	0.947	0.955	0.000	1518	0.703	0.709	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
3	AFDB:A7KVC2	0.818	0.829	0.000	1510	0.323	0.328	A7KVC2.pdb.gz	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
4	AFDB:B2RX12	0.888	0.892	0.000	1523	0.559	0.562	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
5	AFDB:E7F118	0.894	0.908	0.000	1507	0.536	0.545	E7F118.pdb.gz	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
6	AFDB:G5EFP3	0.878	0.856	0.000	1573	0.447	0.435	G5EFP3.pdb.gz	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
7	AFDB:O15438	0.922	0.924	0.000	1527	0.560	0.561	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
8	AFDB:O88269	0.898	0.915	0.000	1502	0.421	0.429	O88269.pdb.gz	MRP6_RAT ATP-binding cassette sub-family C member 6 OS=Rattus norvegicus OX=10116 GN=Abcc6 PE=1 SV=1
9	AFDB:O95255	0.902	0.918	0.000	1503	0.449	0.457	O95255.pdb.gz	MRP6_HUMAN ATP-binding cassette sub-family C member 6 OS=Homo sapiens OX=9606 GN=ABCC6 PE=1 SV=2
10	AFDB:P14772	0.864	0.849	0.000	1559	0.351	0.345	P14772.pdb.gz	BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BPT1 PE=1 SV=2
11	AFDB:P33527	1.000	1.000	0.000	1531	1.000	1.000	P33527.pdb.gz	MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3
12	PDB:6jb1B	0.723	0.804	3.113E-91	1366	0.305	0.342	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
13	PDB:7vluA	0.668	0.866	5.688E-89	1159	0.286	0.378	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
14	PDB:7s5xE	0.711	0.766	2.234E-88	1412	0.307	0.333	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
15	PDB:5ykfB	0.718	0.832	1.999E-85	1309	0.305	0.357	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6c3pE	0.693	0.772	4.833E-85	1359	0.307	0.346	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
17	PDB:6c3oE	0.643	0.753	9.928E-81	1290	0.302	0.359	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:7mitE	0.750	0.796	1.951E-76	1438	0.309	0.329	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:6msmA	0.659	0.836	2.052E-71	1181	0.221	0.286	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:5wuaE	0.704	0.815	2.006E-68	1312	0.301	0.351	5wuaE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	2469	1215	0.787	0.992	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	782	1408	0.300	0.326	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	747	1557	0.305	0.300	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	2260	1518	0.705	0.711	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	1429	1492	0.487	0.500	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	739	1582	0.308	0.298	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	738	1582	0.307	0.297	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	758	1396	0.319	0.350	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	788	1510	0.312	0.316	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RUS7	723	1588	0.306	0.295	B2RUS7_MOUSE ATP-binding cassette, sub-family C (CFTR/MRP), member 8 OS=Mus musculus OX=10090 GN=Abcc8 PE=1 SV=1
11	B2RX12	1797	1523	0.566	0.569	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
12	E1B2R7	741	1426	0.313	0.336	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
13	E7EYG0	755	1426	0.315	0.338	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
14	E7F118	1694	1507	0.538	0.547	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
15	E9Q236	847	1325	0.324	0.374	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
16	F1LR52	834	1288	0.315	0.374	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
17	F1M3J4	855	1325	0.329	0.380	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
18	G5EE72	584	1427	0.253	0.272	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
19	G5EFP3	1228	1573	0.442	0.430	G5EFP3_CAEEL Multidrug resistance-associated protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrp-4 PE=1 SV=1
20	I3L4X2	2926	1440	0.933	0.992	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.045	25.6	AAA ATPase domain
2	PF13304 AAA_21	4.1	18.7	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13401 AAA_22	1.4	20.6	AAA domain
4	PF13476 AAA_23	2.5e+02	13.6	AAA domain
5	PF13479 AAA_24	5.2e+02	11.7	AAA domain
6	PF13481 AAA_25	1.2	20.2	AAA domain
7	PF13555 AAA_29	7.7	17.7	P-loop containing region of AAA domain
8	PF12775 AAA_7	1.8e+02	13.1	P-loop containing dynein motor region
9	PF09818 ABC_ATPase	0.11	23.1	ATPase of the ABC class
10	PF00664 ABC_membrane	8.7e-99	342.2	ABC transporter transmembrane region
11	PF00005 ABC_tran	2e-49	179.0	ABC transporter
12	PF00006 ATP-synt_ab	3.2e+02	12.4	ATP synthase alpha/beta family, nucleotide-binding domain
13	PF10066 DUF2304	3.9e+02	12.7	Uncharacterized conserved protein (DUF2304)
14	PF01935 DUF87	2.1e+02	13.4	Helicase HerA, central domain
15	PF00350 Dynamin_N	2.3e+02	13.2	Dynamin family
16	PF01926 MMR_HSR1	0.037	25.5	50S ribosome-binding GTPase
17	PF00931 NB-ARC	1.6e+02	12.9	NB-ARC domain
18	PF01384 PHO4	38	14.7	Phosphate transporter family
19	PF08477 Roc	4.3e+02	12.5	Ras of Complex, Roc, domain of DAPkinase
20	PF03193 RsgA_GTPase	0.51	21.7	RsgA GTPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382342

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000237612	0.932	ATP-binding cassette sub-family G member 2
2	9606.ENSP00000245539	0.770	Mitochondrial ribosomal protein S7
3	9606.ENSP00000445772	0.728	Leukotriene B4 receptor 2
4	9606.ENSP00000428845	0.669	Voltage-dependent anion-selective channel protein 3
5	9606.ENSP00000333292	0.649	Protein spinster homolog 2
6	9606.ENSP00000354995	0.649	ATP-binding cassette sub-family G member 1
7	9606.ENSP00000249700	0.648	Tropomodulin-2
8	9606.ENSP00000304331	0.641	GS homeobox 1
9	9606.ENSP00000471463	0.634	Uncharacterized protein C19orf48
10	9606.ENSP00000256958	0.619	Solute carrier organic anion transporter family member 1B1
11	9606.ENSP00000289575	0.619	Solute carrier organic anion transporter family member 2B1
12	9606.ENSP00000305974	0.614	Solute carrier organic anion transporter family member 1A2
13	9606.ENSP00000378760	0.602	Major vault protein
14	9606.ENSP00000313681	0.590	Sphingosine kinase 1
15	9606.ENSP00000355964	0.584	Acyl-CoA:lysophosphatidylglycerol acyltransferase 1
16	9606.ENSP00000481728	0.578	ATP-binding cassette sub-family G member 4
17	9606.ENSP00000441269	0.576	Solute carrier organic anion transporter family member
18	9606.ENSP00000295256	0.566	Hematopoietic prostaglandin D synthase
19	9606.ENSP00000296577	0.566	ATP-binding cassette sub-family E member 1
20	9606.ENSP00000261196	0.564	Solute carrier organic anion transporter family member 1B3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005319	0.997	lipid transporter activity
GO:0042910	0.997	xenobiotic transmembrane transporter activity
GO:0008514	0.997	organic anion transmembrane transporter activity
GO:0140359	0.997	ABC-type transporter activity
GO:0015562	0.986	efflux transmembrane transporter activity
GO:0005488	0.985	binding
GO:0005342	0.975	organic acid transmembrane transporter activity
GO:0046943	0.971	carboxylic acid transmembrane transporter activity
GO:0015103	0.964	inorganic anion transmembrane transporter activity
GO:0090482	0.913	vitamin transmembrane transporter activity
GO:0005515	0.802	protein binding
GO:0015075	0.640	monoatomic ion transmembrane transporter activity
GO:0008559	0.572	ABC-type xenobiotic transporter activity
GO:0036094	0.570	small molecule binding
GO:0034040	0.540	ATPase-coupled lipid transmembrane transporter activity
GO:0043225	0.531	ATPase-coupled inorganic anion transmembrane transporter activity
GO:1901702	0.410	salt transmembrane transporter activity
GO:0000166	0.354	nucleotide binding
GO:0003824	0.311	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0051179	0.945	localization
GO:0042221	0.922	response to chemical
GO:0009987	0.920	cellular process
GO:0015711	0.875	organic anion transport
GO:0015849	0.833	organic acid transport
GO:0008152	0.803	metabolic process
GO:0055085	0.789	transmembrane transport
GO:0065007	0.762	biological regulation
GO:0046942	0.759	carboxylic acid transport
GO:0042908	0.654	xenobiotic transport
GO:0044237	0.548	cellular metabolic process
GO:0051716	0.514	cellular response to stimulus
GO:0050789	0.474	regulation of biological process
GO:0071704	0.442	organic substance metabolic process
GO:0050794	0.379	regulation of cellular process
GO:0070887	0.340	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098590	0.976	plasma membrane region
GO:0045178	0.945	basal part of cell
GO:0009925	0.918	basal plasma membrane
GO:0005737	0.852	cytoplasm
GO:0043227	0.742	membrane-bounded organelle
GO:0043229	0.731	intracellular organelle
GO:0043231	0.700	intracellular membrane-bounded organelle
GO:0043230	0.401	extracellular organelle
GO:0065010	0.374	extracellular membrane-bounded organelle
GO:0016323	0.365	basolateral plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.997	Translocases.
EC:7.6.2.2	0.572	ABC-type xenobiotic transporter.

[back to server]